SecReT6
Protein ID: 397659088
SecReT6 ID679
T6SS typei2
Gene symbol-
Locus tagA225_4098
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]4313767..4317168 [-]
Producthypothetical protein
NoteTssM
UniProt IDI6WSE9
KEGG IDkoe:A225_4098
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.90E-69, Aligned region: 158..193
IcmF-related [PF06761], Evalue: 5.90E-69, Aligned region: 412..732
DUF1215 [PF06744], Evalue: 1.50E-36, Aligned region: 852..970
Protein Sequence: 1133 a.a.     [Download]
>gi|397659088|ref|YP_006499790.1| hypothetical protein A225_4098 [Klebsiella oxytoca E718]
MWRGNWGRISITALIAAAIGLAIWKKGDAFGLTSNSLKLLVSVAVIILLLLVRHGKTISLAIKQQWSRFQ
AKRKSLLPADEGRVKQTPPRNVTVDTIRAAMRNLYGRRWGRKTRILLVTGTVSEVEQLTPGLTTQLWQED
RGTLLLWGGDLSTPADSAWLTALRKLRRRPVDGMVWVTSAFDQLSAPGLEQPLPVPSDSTMDFLSHAISI
RMEALGWQLPLYVWSLHPRAGKPEGRITQATGCLLPAGCSTEGLAEQLSALTPDLTSQGLQQTCGEVKHN
FLLTLADQLIREPESVTAPLSVILNPYRPLLLAGVVFSQPSAGAERAVPHHWGMDKRWDALPESVRTLPA
GLRPYKPGIPWRRVMASVVALTMVGWAAWMGIAYVTNRSQIDSANVQAALAARQNQPLEQRLHALSELQK
TLSRLQYRSEFGVPWYEQAGLSQNNALLDALWPRYQDSALPLLRDAAADHLQRQLNAFNVLPAGSPLREQ
MAKNTYDQLKLYLMLARPEHMDAAWFGSALLNDWPMRDGVKNGVWLGMAPSLLSFYGVQLVAHPEWKLRA
DENLVSQARSLLVRLMGVRNSESTLYQKMLTQVSHLYVDMRLEDMTGDTDASRLFSTTEVVPGMFTRQAW
EQAVQPAIEKVVKARRDGLDWVLTDSKRQMNKQDETSPEALKHRLTERYFADFSGAWLEFLNSLRWNQAT
TLSDSIDQLTLMADVRQSPLVALMNTLNVQGRTGQTGEAISDSLVKSAKNLLGGDNQDAIDQSAGVHGPL
DATFGPVLALMDKNRTGAQELSLQSFLTRVTQVRLRLQQVTNAADPQAMTQTLAQTVFQGKSVDLTETRD
YGSLIAAGLGLEWSGFGRTVFVQPMEQAWQQVLTPAAESLNAQWQQAVVAEWNSAFGGRYPFNNSSSDVS
LPLLAKYLNADSGRIAQFLQTRLRGVLHKEGNHWVPDSINSQGLAFNPAFLNAINTLSHISDVAFTEGSA
GMNFELRPGTADGVMQTDMIIDSQKLIYVNQLPAWKRFAWPADTEAPGANLSWVSTQAGTRQYADIPGAW
GWIRLLDKAVVSAYPGVGSSYSLSWKAQDGRTLNYTLRTEAGEGPLALLKLRNFRLPETIFSTTGVAESG
LVASEASEVEEVY
 
Nucleotide Sequence: 3402 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c4317168-4313767 Klebsiella oxytoca E718 chromosome, complete genome
GTGTGGCGTGGTAACTGGGGACGCATCAGTATTACTGCACTGATTGCTGCCGCGATCGGATTAGCTATCT
GGAAAAAGGGCGATGCGTTCGGACTTACCAGTAATAGCCTTAAACTGCTGGTATCTGTGGCGGTGATAAT
TCTTCTGCTACTTGTCCGCCATGGCAAAACTATTAGCCTGGCGATTAAACAACAGTGGTCGCGTTTTCAG
GCGAAGCGTAAAAGTCTCCTGCCTGCTGATGAAGGTCGCGTTAAGCAGACACCGCCACGCAATGTCACCG
TTGATACCATCCGTGCAGCCATGCGTAACCTCTATGGTCGTCGCTGGGGCCGTAAAACACGCATCCTGCT
GGTCACTGGCACTGTATCTGAGGTGGAGCAACTGACCCCAGGGCTCACGACTCAGCTCTGGCAGGAAGAT
CGCGGCACGCTGTTACTGTGGGGCGGTGACCTCAGTACGCCAGCCGACAGTGCCTGGCTTACCGCGCTGC
GCAAACTGCGCCGCCGTCCGGTGGATGGCATGGTATGGGTCACTTCAGCGTTTGACCAGCTCTCAGCGCC
AGGGCTGGAGCAGCCGCTGCCGGTACCTTCAGACAGCACCATGGATTTCCTGTCTCACGCCATCAGCATA
CGTATGGAAGCGCTTGGCTGGCAGCTCCCGCTGTATGTCTGGTCCCTGCACCCACGCGCCGGTAAACCGG
AAGGGCGCATTACGCAGGCAACCGGCTGTTTGTTACCTGCCGGTTGCAGTACCGAAGGGCTGGCAGAGCA
ACTGTCCGCCCTGACGCCAGATTTGACTTCACAGGGGCTGCAGCAGACCTGCGGTGAAGTGAAACATAAC
TTCCTGCTGACGCTTGCCGACCAGCTCATTCGTGAGCCGGAAAGCGTGACCGCACCGCTGTCGGTGATAC
TCAATCCGTACCGTCCGCTTCTACTGGCCGGCGTGGTGTTCAGTCAGCCTTCAGCCGGTGCCGAACGTGC
CGTGCCGCACCACTGGGGCATGGATAAGCGCTGGGATGCCCTGCCGGAGTCTGTCCGGACACTCCCTGCC
GGACTACGTCCGTACAAGCCCGGCATTCCGTGGCGCAGGGTGATGGCGTCTGTTGTTGCTCTTACGATGG
TCGGCTGGGCTGCGTGGATGGGCATCGCGTATGTCACCAACCGCAGCCAGATTGACAGCGCTAATGTCCA
GGCGGCACTTGCCGCCCGACAGAATCAGCCCCTGGAGCAGCGCCTGCACGCGCTGTCTGAACTGCAAAAA
ACGCTGTCCCGTCTGCAGTACCGCTCTGAGTTTGGCGTGCCGTGGTACGAGCAGGCCGGACTAAGCCAGA
ACAATGCGTTGCTGGACGCACTCTGGCCACGTTACCAGGACAGCGCATTGCCGCTGCTGCGGGATGCCGC
CGCTGACCATCTGCAGAGACAACTTAATGCCTTTAATGTATTGCCAGCGGGCAGCCCGCTGCGTGAGCAG
ATGGCAAAAAACACTTATGACCAGCTCAAACTCTACCTGATGCTGGCGCGTCCGGAACATATGGACGCGG
CCTGGTTCGGCTCTGCATTGCTGAATGACTGGCCGATGCGTGACGGTGTAAAAAACGGCGTCTGGCTGGG
GATGGCGCCTTCTCTGCTGTCGTTTTATGGCGTGCAGCTGGTTGCGCACCCTGAATGGAAACTGCGTGCT
GATGAAAATCTGGTCAGCCAGGCGCGTTCCCTGCTGGTTCGTCTGATGGGCGTACGCAACAGCGAATCGA
CCCTGTACCAGAAGATGCTCACTCAGGTGTCGCACCTCTATGTCGATATGCGCCTGGAAGACATGACCGG
CGATACCGATGCATCCCGTCTGTTCAGCACCACGGAAGTCGTGCCCGGGATGTTTACGCGTCAGGCCTGG
GAGCAGGCCGTGCAGCCCGCTATCGAGAAGGTGGTGAAGGCACGCCGGGACGGACTAGACTGGGTGCTGA
CTGACAGCAAGCGTCAGATGAATAAACAGGACGAGACCTCACCGGAAGCTCTGAAACATCGCCTGACGGA
ACGTTACTTTGCCGACTTCAGCGGGGCATGGCTTGAGTTCCTCAACAGCCTGCGCTGGAACCAGGCGACC
ACGCTGTCGGATTCCATTGACCAGTTGACCCTGATGGCCGACGTGCGTCAGTCACCACTGGTGGCGCTGA
TGAACACCCTGAATGTGCAGGGACGCACCGGGCAGACAGGCGAAGCCATTTCGGATTCGCTGGTGAAATC
GGCGAAGAATCTGCTCGGCGGTGATAACCAGGATGCCATTGATCAGAGCGCTGGTGTTCACGGCCCGCTG
GATGCAACCTTTGGTCCGGTACTGGCGCTGATGGACAAAAACCGGACAGGTGCACAGGAGTTGAGTCTGC
AGTCGTTCCTGACCCGCGTGACGCAGGTGCGCCTGCGCCTGCAGCAGGTGACCAATGCCGCCGACCCGCA
GGCGATGACACAGACGCTGGCGCAGACCGTATTTCAGGGTAAGTCGGTCGACCTCACCGAAACCCGTGAC
TACGGCAGCCTGATTGCCGCCGGTCTCGGCCTGGAGTGGAGCGGCTTCGGCCGTACCGTGTTTGTTCAGC
CGATGGAGCAGGCCTGGCAGCAGGTACTGACCCCGGCGGCCGAAAGCCTCAATGCCCAGTGGCAGCAGGC
CGTGGTTGCTGAGTGGAACAGTGCCTTCGGTGGACGCTATCCGTTTAACAATTCCAGCAGTGATGTATCC
CTGCCGCTGCTGGCTAAATACCTCAATGCAGATTCCGGGCGTATTGCGCAGTTCCTGCAAACCCGCCTCA
GAGGCGTGCTGCACAAAGAGGGCAACCACTGGGTGCCGGACAGCATCAACTCGCAGGGGCTGGCCTTTAA
TCCGGCGTTCCTCAATGCCATCAACACCCTGAGCCATATCTCGGATGTCGCTTTCACCGAAGGCAGTGCC
GGCATGAACTTCGAGTTGCGTCCGGGCACTGCCGATGGGGTAATGCAGACTGACATGATTATCGACAGCC
AGAAGCTGATCTATGTAAACCAGTTGCCGGCGTGGAAGCGCTTCGCCTGGCCTGCAGATACCGAGGCTCC
GGGGGCGAACCTGAGCTGGGTAAGCACGCAGGCAGGAACCCGTCAGTACGCCGATATCCCTGGCGCCTGG
GGCTGGATACGTCTGCTCGATAAAGCTGTGGTCAGTGCTTATCCGGGCGTTGGTAGCAGTTACAGCCTGA
GCTGGAAAGCACAGGACGGGCGCACGCTCAATTACACCCTGCGTACAGAGGCGGGCGAGGGGCCACTGGC
GCTGCTGAAACTGCGCAACTTCCGTCTGCCGGAGACGATTTTCAGCACGACTGGCGTGGCCGAATCAGGC
CTGGTCGCCAGCGAGGCCAGCGAAGTAGAAGAGGTCTACTGA
 Primer design