SecReT6
Protein ID: 397661099
SecReT6 ID680
T6SS typei3
Gene symbol-
Locus tagKUI_0088
StrainTaylorella equigenitalis ATCC 35865
Repliconchromosome [GenBank: NC_018108] [Browse all T6SS(s) in this replicon]
Location [Strand]91535..95161 [+]
Producthypothetical protein
NoteTssM
UniProt IDI6W2D3
KEGG IDtea:KUI_0088
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.60E-90, Aligned region: 213..478
ImcF-related_N [PF14331], Evalue: 4.60E-90, Aligned region: 1062..1078
IcmF-related [PF06761], Evalue: 1.70E-79, Aligned region: 232..268
IcmF-related [PF06761], Evalue: 1.70E-79, Aligned region: 529..837
DUF1215 [PF06744], Evalue: 7.00E-33, Aligned region: 720..745
DUF1215 [PF06744], Evalue: 7.00E-33, Aligned region: 948..1070
Protein Sequence: 1208 a.a.     [Download]
>gi|397661099|ref|YP_006501799.1| hypothetical protein KUI_0088 [Taylorella equigenitalis ATCC 35865]
MFSLINLFITRIFSFLFSRALWSFLGLVILSCLIWFLGPALRVGEFAPLESRDVRMYLIIAIFALYFLRL
FWRKYREGRLNAKLLGQLKSKKPKDNEKLTEKEREEVRVLSERFDEAIALLKQSRFENGKDKSLSARFSK
QYLYQLPWYVFIGAPGSGKTTALVNSGLNFPLAEKFGRMALKGVGGTRNCDWWFTDEAVLLDTAGRYTTQ
DSNTATDEDEWKGFLKLLTKYRARQPINGVMLTVSVYDLLASTQEERAKHAVALKKRLQELRDELGTEFP
VYILVTKMDQLHGFEDYFDNLSVEEHQQVWGFTFPYEESQEEGFSFYDSYEKEFQILQERLFDGLPDLLM
KNRNLESSSLAYLLPQQFANLRIVLGTFLTEVFSFSRLESKIVPRGVYFTSGTQGGVSFDKVSEDLKDYL
QIDGISQHNKAPVLEGGKSYFLTDLLQNLIFKESGLAGVNLKWEKRYRQMQWIGYGLVGLLLLGALTLWF
NSYRNNTRYLDFVEEKLPVLQNHSNNIKISESGDVFSILPYLSLVKKLPNGETFNVEDAPFSYGFGLYQG
GKIKSASRSIYDEAIHQVFAPQIAKRIEKRLATMSDANIVVYYEALRAYLMMYEPEHYDKDYFMQWVLHD
VVADKSAQFNNEQFQLLREHMDYLFGQGAFVSPFPLNEELVQLARDRIDAHDLAERAYNRAREILKQDSK
YDVSLMNLAGVQASTVFRRKSGDALNKGVNRIFSYEGYWNNFNKNIEKIAIQLREDDEWVLGINNTKFAD
GSANKLVNDVKKLYFVDYIREWDAFLADVEVIPPKNLSHAIELSRSMSSSNSPLTKFVKGVAADTTLLRE
DVDFQRTLVDRATESASSMASSLTSLMGPLDTGDLIKGKEEPEKLESMVDNHFIDYHELAVSAGNNQDAP
IEGTIDLIEELYNFLTASETALRTKVTLPSQDVISKLQAESGRLPPVVGNMLTSITAEASKAINSGAQAN
IGADINAQIGMSCRNSITNRYPFRSTTRDVAPNDFARFFAPNGLMDQFFNKHLINMVDMSKHPWRFKPGV
DGSKGNIAKYLSSFEKASVIRDVYFAGGKPEPSFKVSIRPVEMDASITQMVLNIDGQTLTYEHGPQIGKS
FDWPGQGSNQVSITLSPIDGTSSLTTNGPWALNRLIDNAKIKNGRSPEVIFATFNIGGRSVKLEITANSA
KSPFRLGEMRSFTCPGVN
 
Nucleotide Sequence: 3627 bp     [Download]
>gi|397661013|ref|NC_018108.1|:91535-95161 Taylorella equigenitalis ATCC 35865 chromosome, complete genome
ATGTTCAGCCTTATAAATTTGTTTATCACAAGAATTTTTAGTTTTTTGTTTAGTAGAGCTTTGTGGTCAT
TTCTTGGCCTTGTAATTCTTTCTTGTTTGATTTGGTTTTTAGGTCCTGCACTAAGGGTTGGAGAGTTTGC
TCCACTTGAATCTCGTGATGTGAGGATGTACTTAATCATTGCCATCTTTGCACTTTATTTCTTAAGGTTG
TTTTGGAGGAAATATCGAGAAGGACGGCTTAATGCAAAGCTCTTAGGACAACTTAAAAGCAAAAAACCTA
AGGACAATGAAAAACTTACCGAGAAAGAGCGTGAAGAAGTCAGAGTATTATCAGAACGCTTCGATGAGGC
GATTGCACTTTTAAAACAATCCCGATTTGAAAATGGTAAAGACAAATCGTTATCTGCTAGATTTTCTAAA
CAATATCTTTATCAATTGCCTTGGTATGTGTTTATTGGGGCTCCAGGTTCAGGTAAAACTACGGCTTTAG
TAAATTCTGGGCTTAATTTTCCATTGGCAGAGAAATTTGGTCGTATGGCTCTTAAAGGCGTGGGAGGTAC
TCGTAATTGTGATTGGTGGTTTACTGATGAGGCTGTACTTCTGGATACCGCAGGTCGATACACTACACAA
GATAGTAATACTGCGACTGACGAAGATGAGTGGAAGGGTTTCTTAAAACTTCTTACAAAATATCGAGCAA
GGCAGCCGATTAATGGTGTTATGTTGACTGTCAGTGTGTACGACTTGCTTGCTTCAACTCAAGAGGAGCG
TGCGAAACACGCAGTTGCACTTAAAAAACGTCTCCAAGAATTACGCGATGAATTGGGTACAGAGTTTCCT
GTTTATATTCTCGTTACTAAGATGGACCAATTGCATGGTTTTGAGGATTACTTCGATAACCTTAGTGTTG
AGGAGCATCAGCAGGTTTGGGGTTTCACGTTCCCGTATGAAGAGTCTCAAGAGGAGGGATTTAGTTTCTA
CGATTCGTACGAAAAAGAATTCCAAATTCTGCAAGAGCGTTTATTCGACGGGCTTCCAGATTTGTTAATG
AAAAACAGGAATTTAGAAAGCAGTTCATTGGCGTATTTATTGCCACAGCAATTTGCAAATTTAAGAATTG
TACTTGGCACTTTCCTAACCGAAGTTTTCTCATTTAGTCGCTTGGAATCTAAAATTGTTCCACGTGGCGT
TTACTTCACTAGCGGAACTCAGGGTGGTGTTAGTTTCGATAAAGTTAGTGAGGACTTAAAAGATTATCTG
CAAATCGACGGCATTTCTCAGCACAACAAAGCACCTGTGCTTGAGGGCGGAAAAAGCTATTTCCTAACCG
ACCTACTTCAAAATTTAATTTTCAAGGAATCAGGTTTGGCTGGTGTGAATCTGAAGTGGGAGAAGCGTTA
TCGTCAAATGCAGTGGATTGGGTATGGTTTAGTTGGGTTGCTTTTGCTAGGAGCCTTAACTCTTTGGTTT
AATAGCTACCGCAATAACACTAGATATCTTGATTTTGTGGAAGAGAAATTACCAGTACTTCAAAATCATA
GTAACAACATTAAAATTTCTGAAAGTGGTGATGTTTTCAGTATATTGCCTTACCTCAGTTTAGTTAAAAA
GCTTCCAAACGGTGAGACTTTCAATGTTGAGGATGCTCCGTTTTCTTATGGCTTTGGTTTGTACCAGGGT
GGCAAAATTAAATCAGCTTCGCGCTCTATATACGATGAGGCTATTCATCAGGTTTTTGCACCTCAGATAG
CTAAAAGAATTGAAAAACGTTTAGCCACAATGAGCGATGCAAATATCGTTGTTTATTACGAGGCTTTACG
TGCTTATTTAATGATGTATGAACCCGAACACTACGATAAAGACTACTTTATGCAGTGGGTGCTTCATGAT
GTAGTAGCCGATAAATCTGCTCAATTCAATAACGAACAGTTCCAGTTACTTCGTGAGCATATGGATTATT
TATTTGGACAGGGTGCTTTTGTATCTCCATTCCCATTAAATGAGGAATTAGTGCAGTTGGCACGTGACCG
TATAGATGCTCATGACTTAGCTGAACGTGCCTACAATCGAGCAAGAGAAATTCTAAAACAAGATTCAAAA
TACGATGTATCACTTATGAACCTTGCTGGGGTGCAGGCCTCCACAGTATTCCGTCGTAAAAGTGGTGATG
CTTTGAATAAAGGTGTAAATAGAATTTTCTCTTATGAGGGATATTGGAATAACTTCAATAAAAATATTGA
AAAGATTGCCATCCAACTTAGAGAAGATGATGAGTGGGTTCTCGGGATTAACAACACAAAATTTGCTGAT
GGCAGTGCAAACAAACTTGTTAATGATGTAAAAAAACTCTACTTTGTAGACTATATCAGGGAGTGGGATG
CCTTCTTAGCGGATGTGGAAGTAATTCCACCTAAAAATTTAAGTCATGCAATTGAGCTTTCTCGCAGTAT
GTCATCATCTAATTCACCTCTTACAAAATTTGTTAAGGGTGTAGCTGCAGACACAACATTGCTTCGTGAG
GATGTTGACTTCCAAAGAACATTGGTTGATAGGGCTACAGAAAGTGCCTCAAGTATGGCATCTTCGCTAA
CTTCCTTGATGGGACCTCTTGATACGGGTGACCTTATTAAGGGTAAAGAAGAGCCTGAAAAACTTGAGTC
CATGGTTGATAACCACTTTATCGATTACCATGAGTTAGCTGTCAGTGCTGGCAATAACCAAGATGCACCT
ATTGAAGGCACTATTGACTTAATCGAGGAGTTATACAATTTCTTGACGGCTTCTGAGACCGCACTTAGGA
CCAAAGTAACATTGCCATCCCAAGATGTTATTTCTAAGCTTCAGGCTGAATCAGGTCGTTTACCACCTGT
TGTGGGTAACATGCTTACTTCGATTACTGCAGAAGCTTCAAAAGCGATTAACTCTGGAGCACAAGCCAAT
ATCGGTGCGGATATTAATGCACAGATAGGTATGTCTTGCAGGAACTCGATTACAAACAGATATCCATTTA
GATCTACTACTAGGGATGTGGCTCCTAATGATTTTGCTAGATTCTTTGCACCAAATGGTTTGATGGATCA
ATTCTTTAATAAGCACTTAATCAATATGGTGGATATGTCCAAACATCCATGGCGTTTTAAACCAGGTGTA
GACGGCTCAAAAGGGAATATTGCCAAATATCTTTCTTCTTTCGAAAAAGCATCTGTAATTCGTGATGTTT
ATTTTGCTGGTGGCAAACCTGAACCTTCTTTTAAAGTGTCTATTAGGCCAGTTGAGATGGATGCAAGTAT
AACTCAGATGGTTCTTAATATTGATGGTCAAACTCTGACTTATGAACACGGTCCACAAATTGGTAAGTCG
TTTGATTGGCCAGGTCAGGGAAGCAATCAAGTTTCAATTACTCTTAGCCCGATTGATGGAACATCATCCT
TGACGACAAATGGTCCATGGGCTTTAAACCGTCTTATCGATAATGCAAAAATTAAAAATGGTCGCTCGCC
TGAAGTAATTTTCGCAACGTTTAATATTGGGGGACGTTCTGTGAAACTTGAAATCACAGCCAATTCCGCT
AAGAGCCCGTTCAGACTTGGCGAGATGCGCAGTTTTACTTGCCCAGGAGTTAACTAA
 Primer design