SecReT6
Protein ID: 397685727
SecReT6 ID681
T6SS typei1
Gene symbol-
Locus tagPSJM300_03050
StrainPseudomonas stutzeri DSM 10701
Repliconchromosome [GenBank: NC_018177] [Browse all T6SS(s) in this replicon]
Location [Strand]685177..686670 [-]
ProductFis family transcriptional regulator
NoteSfa2
UniProt IDI7A618
KEGG IDpsj:PSJM300_03050
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 3.40E-70, Aligned region: 191..358
Sigma54_activ_2 [PF14532], Evalue: 1.40E-22, Aligned region: 192..362
HTH_8 [PF02954], Evalue: 2.70E-14, Aligned region: 226..242
HTH_8 [PF02954], Evalue: 2.70E-14, Aligned region: 450..490
GAF_2 [PF13185], Evalue: 5.40E-07, Aligned region: 24..163
GAF_2 [PF13185], Evalue: 5.40E-07, Aligned region: 253..286
AAA_5 [PF07728], Evalue: 1.10E-06, Aligned region: 214..334
GAF_3 [PF13492], Evalue: 5.10E-06, Aligned region: 25..147
GAF_3 [PF13492], Evalue: 5.10E-06, Aligned region: 200..258
HTH_30 [PF13556], Evalue: 8.30E-06, Aligned region: 446..460
HTH_30 [PF13556], Evalue: 8.30E-06, Aligned region: 464..490
HTH_28 [PF13518], Evalue: 0.0023, Aligned region: 464..487
AAA_2 [PF07724], Evalue: 0.0072, Aligned region: 213..325
AAA [PF00004], Evalue: 0.0092, Aligned region: 215..334
Protein Sequence: 497 a.a.     [Download]
>gi|397685727|ref|YP_006523046.1| Fis family transcriptional regulator [Pseudomonas stutzeri DSM 10701]
MLPSLRHAEFLLERYADLARAINAESLLGRLVETAARLSDCRLSQIYLLDATHTRLMLAAEWCDGLLQPR
EAASLSSDYDGEQLLQYCLCQNRTLCLAELDTSLHASGFLPNIQETWRSLLCQPLQDEHQRVVGLLLVAH
TQSKDLQGLSASLAQLGTFGIAQLHLLQRLHTSGKELSVMPSSPCASGYGLIGDSLHMRAVYQLIGKVLH
SPVSVLLTGETGTGKDLVARAIHDCGYRRSKAFVVQNCAALPEHLLESELFGYRKGAFTGAEQDRTGLLD
AADGGTLFLDEIGDMPLLLQAKLLRVLQEGEVRPLGSTKTHKVDVRIIAATHRNLRAQVEDGRFREDLFY
RLSNFPIELPALRERGEDILRLARHFADKGCAFLQRDLCRWSDAALELLASYAFPGNVRELKAMVERAVL
LCEGGELLPEHFNFRVETGLDSSMNLRERMERVERSLLMDCLRKNGGNQSQAARELGLPRRTLLYRMERL
NISPADL
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|397685123|ref|NC_018177.1|:c686670-685177 Pseudomonas stutzeri DSM 10701 chromosome, complete genome
ATGCTTCCCTCGCTTCGCCATGCCGAATTCCTGCTCGAGCGCTATGCCGATCTGGCACGCGCCATCAACG
CGGAAAGCCTGCTCGGCAGGCTGGTGGAAACCGCCGCACGCCTGAGCGATTGTCGGCTGAGCCAGATCTA
TCTGCTCGATGCCACCCACACGCGCCTGATGCTCGCAGCCGAATGGTGCGACGGCTTGCTGCAGCCACGG
GAGGCAGCGAGCCTGTCCAGCGATTACGATGGCGAGCAGCTGCTGCAGTACTGCCTGTGCCAAAACCGAA
CGCTATGCCTTGCCGAGCTCGACACCAGTCTGCATGCGTCGGGCTTCCTGCCCAATATCCAGGAAACCTG
GCGTAGTCTGCTCTGCCAGCCCCTGCAGGACGAGCACCAACGCGTCGTCGGCCTTCTGCTCGTCGCTCAT
ACACAGTCAAAGGACCTTCAGGGTTTGAGCGCCTCGCTGGCGCAACTGGGCACCTTCGGGATCGCCCAGC
TGCACTTGTTGCAGCGGTTGCATACGAGCGGTAAGGAACTATCGGTAATGCCAAGCAGCCCCTGTGCCAG
CGGATATGGCCTGATCGGCGATAGCCTGCACATGCGCGCGGTGTATCAACTGATCGGCAAAGTCCTGCAT
AGCCCGGTCAGCGTGTTGCTGACCGGGGAAACCGGCACCGGCAAGGACCTGGTTGCACGGGCCATCCATG
ACTGCGGCTATCGGCGCAGCAAGGCCTTCGTCGTGCAGAACTGCGCGGCGCTCCCTGAGCACCTGCTGGA
AAGCGAGCTGTTTGGTTACCGCAAGGGCGCGTTCACCGGAGCCGAGCAGGACCGCACCGGCCTTCTCGAC
GCAGCGGATGGCGGCACACTTTTCCTCGACGAGATCGGCGACATGCCCTTGTTGCTGCAAGCCAAGCTGC
TGCGTGTCTTGCAGGAGGGAGAAGTACGCCCGCTGGGCTCAACCAAGACTCATAAGGTCGACGTGCGCAT
TATCGCCGCCACTCACCGCAACCTGCGCGCACAAGTTGAAGATGGACGATTTCGTGAGGACCTCTTCTAC
CGCCTCTCGAATTTCCCCATCGAGCTGCCGGCCCTGCGCGAGCGTGGCGAAGATATCTTGCGTCTGGCCC
GCCATTTCGCCGACAAAGGCTGTGCCTTTCTCCAACGCGACCTCTGTCGCTGGTCGGACGCGGCACTGGA
GCTTCTCGCCAGCTACGCGTTTCCCGGCAATGTGCGCGAACTGAAGGCCATGGTCGAGCGCGCCGTCCTG
CTCTGTGAAGGCGGCGAGCTGTTGCCGGAACACTTCAACTTTCGCGTCGAAACGGGCCTCGATAGCAGTA
TGAATCTGCGTGAACGCATGGAGCGCGTCGAGCGAAGCCTGTTGATGGACTGCTTGCGCAAGAATGGAGG
CAACCAGAGCCAAGCCGCACGCGAACTTGGCCTGCCCCGTCGGACCCTGCTCTACCGCATGGAACGCCTG
AACATCAGCCCGGCGGATCTATAG
 Primer design