SecReT6
Protein ID: 397685728
SecReT6 ID681
T6SS typei1
Gene symbol-
Locus tagPSJM300_03055
StrainPseudomonas stutzeri DSM 10701
Repliconchromosome [GenBank: NC_018177] [Browse all T6SS(s) in this replicon]
Location [Strand]686681..689260 [-]
ProductATPase
NoteTssH
UniProt IDI6ZXC1
KEGG IDpsj:PSJM300_03055
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.10E-42, Aligned region: 205..224
AAA_2 [PF07724], Evalue: 8.10E-42, Aligned region: 593..758
AAA [PF00004], Evalue: 4.70E-20, Aligned region: 207..338
AAA [PF00004], Evalue: 4.70E-20, Aligned region: 598..723
AAA_5 [PF07728], Evalue: 8.80E-14, Aligned region: 207..227
AAA_5 [PF07728], Evalue: 8.80E-14, Aligned region: 281..337
AAA_5 [PF07728], Evalue: 8.80E-14, Aligned region: 457..513
AAA_5 [PF07728], Evalue: 8.80E-14, Aligned region: 597..717
AAA_16 [PF13191], Evalue: 5.20E-10, Aligned region: 52..72
AAA_16 [PF13191], Evalue: 5.20E-10, Aligned region: 184..227
AAA_16 [PF13191], Evalue: 5.20E-10, Aligned region: 251..285
AAA_16 [PF13191], Evalue: 5.20E-10, Aligned region: 397..520
AAA_16 [PF13191], Evalue: 5.20E-10, Aligned region: 568..631
AAA_16 [PF13191], Evalue: 5.20E-10, Aligned region: 662..690
AAA_16 [PF13191], Evalue: 5.20E-10, Aligned region: 734..832
ClpB_D2-small [PF10431], Evalue: 1.40E-09, Aligned region: 445..463
ClpB_D2-small [PF10431], Evalue: 1.40E-09, Aligned region: 767..835
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 206..302
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 596..686
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 796..829
AAA_25 [PF13481], Evalue: 2.70E-06, Aligned region: 207..231
AAA_25 [PF13481], Evalue: 2.70E-06, Aligned region: 263..303
AAA_25 [PF13481], Evalue: 2.70E-06, Aligned region: 594..629
Sigma54_activat [PF00158], Evalue: 1.40E-05, Aligned region: 201..221
Sigma54_activat [PF00158], Evalue: 1.40E-05, Aligned region: 597..715
NACHT [PF05729], Evalue: 1.80E-05, Aligned region: 207..234
NACHT [PF05729], Evalue: 1.80E-05, Aligned region: 597..630
NACHT [PF05729], Evalue: 1.80E-05, Aligned region: 800..825
AAA_19 [PF13245], Evalue: 2.50E-05, Aligned region: 204..230
AAA_19 [PF13245], Evalue: 2.50E-05, Aligned region: 595..619
IstB_IS21 [PF01695], Evalue: 5.80E-05, Aligned region: 193..226
IstB_IS21 [PF01695], Evalue: 5.80E-05, Aligned region: 597..615
AAA_17 [PF13207], Evalue: 0.00018, Aligned region: 207..256
AAA_17 [PF13207], Evalue: 0.00018, Aligned region: 596..631
AAA_18 [PF13238], Evalue: 0.00031, Aligned region: 207..232
AAA_18 [PF13238], Evalue: 0.00031, Aligned region: 598..634
AAA_29 [PF13555], Evalue: 0.00055, Aligned region: 201..223
AAA_29 [PF13555], Evalue: 0.00055, Aligned region: 595..622
AAA_23 [PF13476], Evalue: 0.00075, Aligned region: 207..224
AAA_23 [PF13476], Evalue: 0.00075, Aligned region: 439..510
AAA_23 [PF13476], Evalue: 0.00075, Aligned region: 595..634
Clp_N [PF02861], Evalue: 0.0014, Aligned region: 35..72
Clp_N [PF02861], Evalue: 0.0014, Aligned region: 101..122
Clp_N [PF02861], Evalue: 0.0014, Aligned region: 498..513
ResIII [PF04851], Evalue: 0.0027, Aligned region: 189..227
ResIII [PF04851], Evalue: 0.0027, Aligned region: 276..289
ResIII [PF04851], Evalue: 0.0027, Aligned region: 569..625
Arch_ATPase [PF01637], Evalue: 0.003, Aligned region: 187..221
Arch_ATPase [PF01637], Evalue: 0.003, Aligned region: 259..291
Arch_ATPase [PF01637], Evalue: 0.003, Aligned region: 596..609
Arch_ATPase [PF01637], Evalue: 0.003, Aligned region: 668..679
DUF258 [PF03193], Evalue: 0.003, Aligned region: 174..224
DUF258 [PF03193], Evalue: 0.003, Aligned region: 596..609
AAA_14 [PF13173], Evalue: 0.0034, Aligned region: 207..342
AAA_14 [PF13173], Evalue: 0.0034, Aligned region: 596..684
Protein Sequence: 859 a.a.     [Download]
>gi|397685728|ref|YP_006523047.1| ATPase [Pseudomonas stutzeri DSM 10701]
MINVDLQQLVQALDAETRRDLENAAERCVVRGGSKVLVEDLLLGLLERSDGLLVRALQDAAVDAGELAQA
LQPQGENSESRNPVFSSELVQWLQDALLAASLELGQSHVDQAALILALLRNPLRYAGSHYQPLLAKLNAE
RLREFALAQQPQQAGQPAAPGDTNLQRFTHNFTQQARDGKLDPVLCRDAAIRQMIDILARRRKNNPIVVG
EAGVGKTAIVEGLALRIAHGEVPDALKGVELLCLDLGLLQAGASVKGEFERRLQGVIDEVKNSPKPIILF
IDEAHTLIGAGGQAGSGDAANLLKPALARGELRTIAATTWSEYKKYFEKDPALARRFQPVQLHEPSVDEA
ITILRGLAPVYEKSHGIYLRDDAVVAAAELSARYLAGRQLPDKAVDVLDTACARVRISLAAAPEVLERLR
NEIAEGERQHKALERDQEAGLPIDTQNLDRLYARLAKAQTELEQIETRWTEQRELAERMLELRRQCAAAR
VDDERVTCLEELEADLRALQARLAAAQAQERLVSHEVCPRLVAEVISHWTGVPLSQLAREHNSKVITFAS
DLGNRVRGQKQAVEALDRAMRATAAGLNKPDAPVGVFLLVGPSGVGKTETALALADLLYGGERFLTTINM
SEFQEKHSVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVILLDEVEKADPEVMNVFYQVFDKGVANDGEG
REINFRNTLILMTSNLASDRIESLCADGQRPEVSTLEQAIRPKLTQHFKPALLARMRVVPYYPVNGEVLN
ELVALKLARFGERLARRQLQFSYSQALLEHLSQRCDNGNSGARLIDQLIDQHLQPLVVDRLLDAMAGGEP
LQRVHATLDGEGAVICEFA
 
Nucleotide Sequence: 2580 bp     [Download]
>gi|397685123|ref|NC_018177.1|:c689260-686681 Pseudomonas stutzeri DSM 10701 chromosome, complete genome
ATGATCAACGTCGATTTGCAACAGCTGGTACAGGCGCTGGATGCCGAAACCCGCCGTGACCTGGAAAACG
CAGCCGAGCGCTGCGTCGTACGAGGGGGCAGCAAGGTGCTGGTGGAGGACCTGCTGCTCGGCCTGCTGGA
GCGCAGCGATGGTCTGCTGGTGCGGGCCTTGCAGGATGCAGCTGTCGATGCGGGCGAACTGGCCCAGGCG
CTGCAGCCCCAGGGCGAGAATAGCGAATCGCGCAACCCGGTATTTTCCAGCGAGCTGGTGCAATGGCTGC
AGGACGCCCTGCTGGCAGCGAGCCTCGAGCTCGGCCAAAGCCACGTGGACCAGGCGGCGCTGATTCTGGC
TTTGCTGCGCAATCCCCTGCGCTATGCCGGCAGCCATTACCAGCCACTGTTAGCGAAACTCAATGCCGAA
CGCCTGCGCGAATTCGCTCTGGCCCAACAGCCACAACAAGCTGGCCAGCCGGCCGCACCGGGCGATACCA
ACCTCCAGCGCTTCACCCACAACTTCACCCAGCAAGCCCGCGACGGCAAGCTTGACCCGGTACTCTGCCG
CGATGCGGCGATCCGCCAGATGATCGACATCCTCGCCCGCCGGCGCAAGAACAACCCCATCGTGGTCGGC
GAGGCAGGTGTCGGCAAGACCGCCATCGTCGAAGGGCTGGCACTGCGCATCGCCCATGGCGAGGTGCCCG
ATGCGTTGAAGGGCGTCGAACTGCTGTGCCTCGACCTCGGCCTGCTGCAAGCAGGTGCCAGCGTTAAGGG
CGAGTTCGAGCGTCGTCTTCAGGGCGTGATCGATGAAGTAAAGAACTCGCCGAAGCCCATCATCCTTTTC
ATCGACGAAGCCCATACCCTGATCGGCGCTGGCGGCCAGGCCGGCAGCGGAGATGCCGCCAACCTGCTCA
AGCCGGCTCTCGCACGTGGCGAGCTCCGTACCATCGCCGCAACGACCTGGAGCGAGTACAAGAAATACTT
CGAGAAAGACCCTGCGCTGGCGCGGCGCTTTCAGCCCGTGCAACTGCATGAACCGAGCGTCGACGAAGCC
ATCACCATCCTCCGCGGCCTGGCGCCGGTCTATGAAAAGAGTCACGGCATCTATCTGCGCGACGACGCGG
TGGTCGCCGCGGCCGAGCTATCCGCACGCTATCTGGCCGGACGCCAGCTGCCGGACAAAGCCGTGGACGT
GCTTGATACAGCCTGCGCACGGGTGCGCATCAGCCTCGCGGCCGCGCCCGAGGTATTGGAACGTCTGAGA
AACGAAATCGCCGAGGGCGAACGCCAGCATAAGGCGCTGGAGCGCGACCAGGAGGCCGGGCTGCCAATCG
ACACGCAGAATCTGGATCGCCTCTACGCTCGTCTGGCCAAAGCACAAACCGAACTGGAGCAGATCGAAAC
ACGCTGGACCGAGCAACGTGAACTGGCCGAGCGAATGCTCGAGCTGCGCAGACAGTGCGCAGCCGCACGC
GTGGACGACGAACGGGTGACGTGCCTGGAAGAACTCGAAGCCGATCTGCGAGCGCTCCAGGCACGGCTGG
CTGCAGCGCAGGCACAGGAACGGCTGGTTAGCCACGAAGTCTGCCCCCGCCTGGTCGCCGAGGTGATCAG
TCACTGGACCGGTGTGCCGCTGTCGCAGCTGGCGCGCGAGCACAACAGCAAGGTGATCACCTTCGCCAGC
GATCTCGGCAACCGCGTTCGCGGACAGAAGCAGGCGGTCGAAGCGCTCGACCGGGCCATGCGCGCCACGG
CTGCCGGCCTGAACAAACCCGACGCGCCGGTAGGCGTCTTCCTGCTGGTCGGCCCCAGCGGCGTCGGCAA
GACGGAAACCGCGCTGGCACTGGCGGACTTGCTGTATGGCGGCGAGCGCTTCCTGACCACCATCAACATG
TCCGAATTCCAGGAAAAGCACAGCGTTTCACGACTGATCGGCGCCCCACCGGGCTATGTCGGCTACGGCG
AAGGCGGCATGCTCACCGAAGCCGTGCGCCAGAAACCCTATTCCGTGATCCTGCTGGATGAAGTCGAAAA
AGCCGACCCGGAAGTGATGAATGTCTTCTATCAGGTCTTCGACAAGGGCGTGGCCAACGATGGCGAAGGT
CGCGAGATCAATTTCCGCAACACGCTGATCCTGATGACGTCGAATCTCGCCAGCGATCGCATCGAGAGCC
TGTGTGCCGATGGCCAGCGACCCGAGGTGAGCACGCTCGAGCAAGCCATTCGCCCGAAATTGACCCAGCA
TTTCAAACCAGCATTGCTGGCACGCATGCGCGTGGTGCCGTACTACCCGGTCAATGGCGAGGTGCTGAAC
GAACTGGTGGCGCTGAAGCTCGCGCGTTTTGGCGAACGCCTGGCTCGACGCCAGTTGCAATTCAGTTACT
CGCAGGCACTGCTCGAGCACCTCTCTCAACGTTGCGACAACGGTAACAGCGGCGCCCGCCTGATTGATCA
GCTGATCGACCAGCACCTGCAGCCACTGGTAGTGGATCGTCTGCTCGATGCCATGGCCGGTGGCGAACCC
CTGCAGCGGGTACATGCGACACTCGATGGCGAAGGAGCTGTGATCTGTGAGTTCGCTTGA
 Primer design