SecReT6
Protein ID: 397685729
SecReT6 ID681
T6SS typei1
Gene symbol-
Locus tagPSJM300_03060
StrainPseudomonas stutzeri DSM 10701
Repliconchromosome [GenBank: NC_018177] [Browse all T6SS(s) in this replicon]
Location [Strand]689265..690281 [-]
Producthypothetical protein
NoteTssG
UniProt IDI6ZBV8
KEGG IDpsj:PSJM300_03060
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.60E-86, Aligned region: 19..321
Protein Sequence: 338 a.a.     [Download]
>gi|397685729|ref|YP_006523048.1| hypothetical protein PSJM300_03060 [Pseudomonas stutzeri DSM 10701]
MDAAHGSTTVALNPLRRGIREYSLFQGVLLVLDRLRKAHPELDDESLYERLEFEANPSLGFPGSDIDQVQ
FFEEKGELRARLRVNLIGLFGSSSPLPAFYGEQALGDGEDGNPTRAFLDLFNNRLQRLMLPIWQKYRYRA
RFTSGARDPFSSQLFALIGLRGETIRGASELNWKRLLPYLGLLSLRAHSAALIESVLRYYFKHAELHIEQ
CLERRVEILQEQRNRLGMANSELGESLVLGEQVRDRGGKFRIHILQLSWDRFHEFLPIGNGYQPLCALVR
FTLRDPLDYDLRLQLRADDIRELRIGSDNTCRLGWTSWLGRERADGLVTLGTARTQQG
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|397685123|ref|NC_018177.1|:c690281-689265 Pseudomonas stutzeri DSM 10701 chromosome, complete genome
ATGGACGCCGCGCATGGGTCAACAACCGTTGCTCTGAATCCGTTGCGCCGCGGCATTCGCGAGTACAGCC
TGTTCCAGGGCGTGCTACTGGTGCTGGATAGGCTGCGCAAGGCACATCCGGAACTGGATGACGAATCGCT
GTACGAACGTCTGGAGTTCGAGGCCAACCCGAGCCTGGGCTTTCCCGGCAGCGATATCGATCAGGTGCAG
TTCTTCGAGGAAAAGGGCGAGCTGCGCGCGCGTCTGCGGGTCAATCTGATCGGGTTGTTCGGCTCTTCCT
CGCCGCTGCCGGCATTCTATGGCGAGCAGGCCCTGGGTGACGGCGAGGATGGCAATCCGACACGCGCCTT
TCTCGATCTGTTCAACAACCGACTGCAGCGGCTGATGCTGCCGATCTGGCAGAAGTATCGCTATCGCGCA
CGCTTTACCAGCGGCGCGCGCGATCCTTTCTCCTCGCAGCTGTTCGCGCTGATCGGCCTGCGTGGCGAAA
CCATCCGCGGCGCCAGTGAGCTGAACTGGAAGCGTCTGCTGCCCTACCTCGGGTTGCTCAGCCTGCGAGC
CCATTCGGCGGCGCTGATCGAGTCGGTGCTGCGCTACTACTTCAAGCACGCCGAACTCCATATCGAGCAA
TGCCTGGAACGACGCGTCGAGATCCTACAGGAGCAGCGCAACCGACTGGGCATGGCCAACAGCGAACTGG
GCGAAAGCCTGGTGCTGGGCGAGCAGGTACGCGATCGAGGCGGCAAGTTCCGCATCCACATCCTCCAGCT
CAGCTGGGATCGCTTTCACGAATTCCTGCCGATCGGCAACGGCTACCAGCCACTCTGCGCGCTGGTGCGC
TTCACCCTGCGCGACCCGCTCGATTACGACCTGCGCTTGCAACTGCGCGCCGACGACATTCGCGAGCTGC
GCATCGGCTCGGACAATACCTGCCGCCTCGGCTGGACCAGCTGGCTCGGGCGCGAACGCGCCGATGGCCT
GGTCACGTTGGGAACGGCCCGCACTCAACAAGGATAG
 Primer design