SecReT6
Protein ID: 397685730
SecReT6 ID681
T6SS typei1
Gene symbol-
Locus tagPSJM300_03065
StrainPseudomonas stutzeri DSM 10701
Repliconchromosome [GenBank: NC_018177] [Browse all T6SS(s) in this replicon]
Location [Strand]690245..692035 [-]
Producthypothetical protein
NoteTssF
UniProt IDI7A9X7
KEGG IDpsj:PSJM300_03065
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.50E-191, Aligned region: 3..596
Protein Sequence: 596 a.a.     [Download]
>gi|397685730|ref|YP_006523049.1| hypothetical protein PSJM300_03065 [Pseudomonas stutzeri DSM 10701]
MSFNHYYQSELTALRELGKRFAERNPALAPFLGQSGRDPDVERLLEGFAFLTGRLRQKLDDELPELTHSL
MHLLWPNYMRPLPAFSMLQFDPLKRPGPALTVARNTPVESRPVQGVACRFRTAYETEVLPLALQALEYSV
KGNGALLSLRLRMSADGHIGEVGLKRLRLHLAGEPYISQLLYLGLLRHLGGIEVVVLDDQGKPLLGADEQ
PLTPLRLNAGQVEPVGFAEDQALIPYPLNTFRGYRYLQEYFVFPDKFLFVDIKGLEILARLPEERLKQAR
GLELRFDIQKAGAQRIRPTLDNVRLYCTPVVNLFQHDATPIRLDGRQDQYLLRPAEFVPQQCGVFSVDRV
TGWKPGGRGYEEYVHFESFEHDPSFDVPLSRPHYSIRQQPSLLGEGQDTYLSFGLRHHNQHETLSVELTC
TNQNLPRQLKLGDICMPSEDTPEFLTFRNISAVTPSYAPPLEQDFLWKLISNMSLNYLSLANVEALKVIL
ETYDLPRHYDKHAESVSRRRLGGLKGIAHEHVDRLYRGLPVRGVRTDLAMDLESFIGEGDLFLFASVLNE
FFALYASLNSYHELRVRSTQGEVYQWTPRMGQQPLL
 
Nucleotide Sequence: 1791 bp     [Download]
>gi|397685123|ref|NC_018177.1|:c692035-690245 Pseudomonas stutzeri DSM 10701 chromosome, complete genome
ATGTCTTTCAACCATTACTACCAGAGCGAACTCACCGCCCTGCGCGAGCTCGGCAAGCGGTTCGCCGAGC
GCAACCCGGCCCTGGCGCCCTTTCTGGGCCAGAGCGGACGGGATCCGGATGTCGAGCGGCTATTGGAAGG
CTTCGCCTTTCTCACAGGACGCCTGCGGCAGAAACTCGACGACGAACTGCCGGAGCTGACCCACTCGCTG
ATGCATCTGCTGTGGCCGAACTACATGCGCCCGCTGCCGGCATTCAGCATGCTGCAGTTCGATCCGCTGA
AGCGACCGGGACCGGCGCTGACGGTGGCGCGCAACACCCCTGTCGAGTCCCGGCCGGTACAGGGCGTGGC
TTGCAGGTTCCGCACCGCCTACGAAACGGAAGTGCTGCCACTGGCGCTGCAAGCGCTGGAATATTCGGTC
AAGGGTAACGGCGCGCTGCTCAGTCTGCGTCTTCGGATGAGCGCCGATGGGCATATCGGCGAAGTGGGAC
TCAAGCGCTTGCGTCTGCATCTGGCAGGCGAGCCTTACATCAGCCAGCTGCTTTACCTCGGCCTGCTACG
GCATCTCGGCGGTATCGAAGTGGTGGTCCTGGACGATCAGGGCAAGCCGCTGCTGGGCGCGGACGAGCAA
CCTCTGACGCCTCTGCGACTGAACGCCGGGCAAGTCGAGCCGGTAGGCTTCGCCGAAGACCAGGCATTGA
TTCCCTACCCGCTCAATACCTTTCGCGGCTACCGCTACCTGCAGGAATACTTCGTCTTTCCCGACAAATT
CCTGTTCGTCGACATCAAGGGCCTCGAGATCCTGGCACGTCTGCCGGAAGAGCGGCTCAAGCAGGCGCGC
GGCCTGGAGCTGCGCTTCGATATCCAGAAAGCCGGTGCACAACGTATCCGCCCCACGCTGGACAACGTGC
GGCTGTACTGCACGCCGGTGGTCAACCTGTTTCAGCACGACGCCACGCCGATTCGCCTCGACGGCCGGCA
GGACCAGTACCTGTTGCGCCCCGCCGAGTTCGTGCCCCAGCAATGCGGCGTCTTCTCGGTGGACCGCGTG
ACCGGCTGGAAACCCGGCGGCCGGGGTTACGAGGAATACGTCCACTTCGAATCCTTCGAGCACGATCCCA
GCTTCGACGTGCCGCTGTCGCGCCCGCACTACAGCATCCGCCAGCAACCCTCACTGCTGGGCGAGGGCCA
GGACACCTACCTGAGCTTCGGACTGCGCCATCACAACCAGCACGAAACGCTGTCGGTCGAGCTGACCTGC
ACCAACCAGAACCTGCCGCGCCAACTCAAGCTCGGCGACATCTGCATGCCCAGCGAGGACACGCCCGAGT
TCCTCACTTTCCGCAACATCAGCGCGGTCACGCCTAGCTATGCGCCGCCGCTGGAGCAGGATTTCCTCTG
GAAGTTGATCAGCAACATGTCGCTGAACTACCTGTCGCTGGCCAACGTCGAGGCGCTCAAGGTCATTCTC
GAAACCTATGACCTGCCGCGCCACTACGACAAGCACGCCGAAAGCGTCAGTCGCCGCCGGCTTGGCGGGC
TGAAGGGCATCGCCCACGAGCATGTCGATCGCCTGTACCGCGGCCTACCGGTGCGTGGTGTGAGAACCGA
CCTGGCCATGGATCTGGAGAGCTTCATCGGCGAAGGCGACCTGTTCCTCTTCGCCTCGGTGCTCAATGAA
TTTTTCGCCCTGTACGCCAGCCTCAACTCGTATCACGAGCTGCGCGTGCGGAGCACACAGGGAGAGGTGT
ATCAATGGACGCCGCGCATGGGTCAACAACCGTTGCTCTGA
 Primer design