SecReT6
Protein ID: 397685732
SecReT6 ID681
T6SS typei1
Gene symbol-
Locus tagPSJM300_03075
StrainPseudomonas stutzeri DSM 10701
Repliconchromosome [GenBank: NC_018177] [Browse all T6SS(s) in this replicon]
Location [Strand]692457..692873 [-]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDI7A622
KEGG IDpsj:PSJM300_03075
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.40E-19, Aligned region: 26..114
Protein Sequence: 138 a.a.     [Download]
>gi|397685732|ref|YP_006523051.1| GPW/gp25 family protein [Pseudomonas stutzeri DSM 10701]
MNGYGSLFERLAGDAGLRAGWSHEIAAMDSVATHLSKMLSTRAGSVQTLPDYGLPDLNDMRLSLHDSLQQ
ARVAIERFIEAYEPRLSQVRVVSLPRDHDLLRLAFAIEGLLEVDGIKRKVSFSASLDGSGQVKVQGNG
 
Nucleotide Sequence: 417 bp     [Download]
>gi|397685123|ref|NC_018177.1|:c692873-692457 Pseudomonas stutzeri DSM 10701 chromosome, complete genome
TTGAACGGATACGGCAGCCTTTTCGAACGCCTCGCCGGCGATGCCGGCCTGCGCGCGGGCTGGAGTCACG
AGATCGCGGCGATGGACTCGGTGGCCACCCATCTGTCCAAGATGCTCAGCACCCGGGCGGGCAGCGTGCA
GACGCTGCCCGACTACGGGTTACCCGATTTGAACGACATGCGCCTGTCGCTGCACGACTCGTTGCAACAG
GCGCGTGTCGCCATCGAACGCTTCATCGAAGCCTACGAACCACGCTTGAGTCAGGTCCGGGTAGTTTCCC
TGCCCCGTGACCACGACCTGCTTCGCCTCGCCTTCGCCATCGAAGGCCTGCTGGAAGTCGATGGAATCAA
GCGCAAGGTCAGCTTCTCCGCCAGCCTGGATGGCAGCGGGCAAGTGAAGGTTCAAGGCAACGGCTAA
 Primer design