SecReT6
Protein ID: 397685733
SecReT6 ID681
T6SS typei1
Gene symbol-
Locus tagPSJM300_03080
StrainPseudomonas stutzeri DSM 10701
Repliconchromosome [GenBank: NC_018177] [Browse all T6SS(s) in this replicon]
Location [Strand]692888..694363 [-]
Producthypothetical protein
NoteTssC
UniProt IDI6ZXC6
KEGG IDpsj:PSJM300_03080
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.30E-193, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|397685733|ref|YP_006523052.1| hypothetical protein PSJM300_03080 [Pseudomonas stutzeri DSM 10701]
MTTTAAAVETGNLAEAGILDRIIAETRLTPDDEAYDIAKRGVSAFIEELLKPQNENEPVKKAMVDRMIAE
IDAKLSRQMDEILHHPEFQALESSWRGLKLLVDRTNFRENIKLEILNASKQDLLEDFEDSPEIVQSGLYK
HIYTAEYGQFGGQPVGALIANYFFDPSAPDVKTLQYVASVASMSHAPFVAAAGPKFFGLESFTGLPDLKD
LKDHFEGPQFAKWQSFREQEDARYVGLTVPRFLLRNPYDPEDNPVKSFVYKENVANSHEHYLWGNTAYTF
ASRLTDSFAKFRWCPNIIGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFIALTMRK
GSDNAAFFSANSAQKPKFFGNSEEGKTAELNYKLGTQLPYLFIVNRLAHYLKVLQREQIGAWKERTDLEL
ELNKWIRQFVADQENPSAEVRSRRPLRAAQVNVSDVEGEPGWYRVSLSVRPHFKYMGADFTLSLVGKLDK
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|397685123|ref|NC_018177.1|:c694363-692888 Pseudomonas stutzeri DSM 10701 chromosome, complete genome
ATGACTACAACCGCAGCCGCCGTCGAAACCGGCAACCTCGCCGAAGCCGGCATCCTCGACCGCATCATCG
CCGAAACCCGCCTGACCCCGGATGACGAGGCCTACGACATCGCCAAGCGCGGCGTATCGGCCTTCATCGA
GGAACTGCTCAAACCGCAGAATGAAAACGAGCCGGTGAAGAAGGCGATGGTCGATCGAATGATCGCCGAG
ATCGACGCCAAGCTCAGCCGGCAGATGGACGAGATTCTCCACCACCCCGAGTTCCAGGCGCTGGAATCCT
CCTGGCGCGGCCTCAAACTGCTGGTGGACCGCACCAATTTCCGCGAGAACATCAAGCTGGAGATCCTCAA
CGCCTCCAAGCAGGACCTGCTGGAAGACTTCGAGGACAGCCCGGAGATCGTCCAGTCCGGCCTCTACAAG
CACATCTATACCGCCGAGTATGGCCAGTTCGGCGGCCAGCCGGTAGGCGCCCTGATCGCCAACTATTTCT
TTGACCCGAGCGCACCCGACGTCAAGACCCTGCAGTATGTGGCCAGCGTCGCCAGCATGTCCCACGCGCC
CTTCGTCGCGGCAGCCGGGCCGAAATTCTTCGGCCTGGAAAGCTTCACCGGGCTGCCTGACCTGAAGGAT
CTCAAGGATCACTTCGAAGGCCCGCAATTCGCCAAGTGGCAGAGCTTCCGCGAGCAGGAAGATGCCCGCT
ACGTGGGTCTCACCGTTCCGCGCTTCCTGCTGCGCAACCCCTATGACCCCGAAGACAACCCGGTCAAAAG
CTTCGTCTACAAGGAAAACGTCGCCAACAGCCACGAGCATTATCTCTGGGGCAACACCGCCTATACCTTC
GCCAGCCGCCTGACCGACAGCTTCGCCAAGTTCCGCTGGTGTCCGAACATCATCGGCCCGCAGAGCGGTG
GCGCGGTGGAAGACCTGCCGCTGCATCATTTCGAAAGCATGGGCGAGATCGAGACCAAGATTCCCACCGA
AGTGCTGGTATCCGACCGTCGCGAGTACGAGCTGGCCGAAGAAGGCTTCATCGCCCTGACCATGCGCAAA
GGCAGCGACAACGCTGCATTCTTCTCCGCCAACTCGGCGCAGAAGCCGAAGTTCTTCGGCAACAGCGAGG
AAGGCAAGACCGCCGAACTGAACTACAAGCTCGGCACCCAGCTGCCCTACCTGTTCATCGTCAACCGCCT
GGCACACTACCTGAAGGTGCTGCAGCGCGAGCAGATCGGCGCCTGGAAGGAGCGCACCGACCTGGAGCTG
GAGCTGAACAAGTGGATTCGCCAGTTCGTTGCCGACCAGGAGAACCCCAGCGCCGAAGTGCGCAGCCGTC
GCCCGTTGCGCGCCGCCCAGGTCAACGTCAGCGACGTGGAAGGCGAGCCGGGCTGGTACCGCGTCAGCCT
GAGCGTCCGGCCGCACTTCAAGTACATGGGTGCCGACTTCACCCTGTCGCTGGTCGGCAAGCTGGATAAA
GAGTGA
 Primer design