SecReT6
Protein ID: 397685734
SecReT6 ID681
T6SS typei1
Gene symbol-
Locus tagPSJM300_03085
StrainPseudomonas stutzeri DSM 10701
Repliconchromosome [GenBank: NC_018177] [Browse all T6SS(s) in this replicon]
Location [Strand]694385..694891 [-]
Producthypothetical protein
NoteTssB
UniProt IDI6ZBW3
KEGG IDpsj:PSJM300_03085
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-55, Aligned region: 5..159
Protein Sequence: 168 a.a.     [Download]
>gi|397685734|ref|YP_006523053.1| hypothetical protein PSJM300_03085 [Pseudomonas stutzeri DSM 10701]
MAKEGSVAPKERINVTFKPATGNAQEEIELPLKLMVLGDFTQRADDRKIEERKPISIDKNSFDEVLAKQE
LSLTLGVPNRLNDEAVDEDLAVQLKINSMKDFNPASLVEQVPELKKLMELRDALVALKGPLGNAPAFRKA
IESVLSDDDSRERVLGELGLAAKNKLDA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|397685123|ref|NC_018177.1|:c694891-694385 Pseudomonas stutzeri DSM 10701 chromosome, complete genome
ATGGCCAAAGAAGGCTCAGTAGCACCCAAGGAGCGTATCAACGTCACCTTCAAGCCCGCCACCGGCAACG
CCCAGGAGGAAATCGAACTGCCATTGAAGCTGATGGTACTGGGCGATTTCACCCAGCGCGCCGACGATCG
CAAGATCGAAGAGCGCAAGCCCATTTCCATCGACAAGAACAGTTTCGATGAAGTCCTGGCCAAGCAGGAG
CTGAGCCTGACCCTGGGCGTACCCAATCGCCTGAACGACGAAGCCGTCGACGAAGACCTGGCCGTTCAGC
TGAAAATCAACTCGATGAAGGACTTCAACCCCGCCAGCCTGGTCGAGCAGGTGCCGGAACTGAAGAAGCT
GATGGAATTGCGCGACGCGCTGGTCGCACTCAAGGGCCCGCTGGGCAACGCGCCCGCCTTCCGCAAGGCC
ATCGAGAGCGTGCTTTCCGACGACGACTCGCGCGAGCGCGTACTCGGCGAGCTGGGCCTCGCCGCCAAGA
ACAAGCTGGACGCCTGA
 Primer design