SecReT6
Protein ID: 397685735
SecReT6 ID681
T6SS typei1
Gene symbol-
Locus tagPSJM300_03090
StrainPseudomonas stutzeri DSM 10701
Repliconchromosome [GenBank: NC_018177] [Browse all T6SS(s) in this replicon]
Location [Strand]694910..696400 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDI7A9Y2
KEGG IDpsj:PSJM300_03090
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.30E-20, Aligned region: 34..94
ImpA-rel_N [PF06812], Evalue: 5.30E-20, Aligned region: 126..143
Protein Sequence: 496 a.a.     [Download]
>gi|397685735|ref|YP_006523054.1| ImpA domain-containing protein [Pseudomonas stutzeri DSM 10701]
MSFSGSDIRYCSDYELLENELGKATALHETAGTDWEKVGEVSEALLRTQSKDLRIAAWLTWSLYQRESFV
GLQAGLGMLRYLCSERWETLFPQKSRTRIAAFTWLIPRMEQAVAEHVAIGEQLGLFTRMAEDLRALDACL
REHLGEESAPLLLPLGRRLEEMVKRASQGQPQPGPIENAIAQVKQVFNTSPTVENEKDAHKQLRVLQDQA
RPLCSWWLKQKTTDIKPLRLTRTLLWLPIDSLPERNAEQITALRGIPADKLASYRERFSQGLYADLLVDL
EASTARAPFWLDGQRLAWECLQELNADLAMRELEIQLALFLKRLPGLDELRFHDGTPFADAETRAWISAQ
VLPTLDPAPATSEPDSIQNGTTPTWEEALQNVLPQLRKDGLKPAVQQLKKGLATARGGRERFFWQLTLAR
LCYQAKKYELAKTQLETLDQTLKATGLADWEPDLALEILRLLHSCCELLPQNHATRESKDEIYRRLCHLD
LEVVLD
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|397685123|ref|NC_018177.1|:c696400-694910 Pseudomonas stutzeri DSM 10701 chromosome, complete genome
GTGTCGTTCTCCGGCAGTGATATTCGCTATTGCAGCGACTATGAACTACTGGAAAACGAACTGGGCAAGG
CCACGGCCCTGCACGAGACGGCAGGCACCGATTGGGAAAAGGTAGGCGAAGTCAGCGAAGCGCTTCTGCG
CACCCAGTCGAAGGACTTGCGTATCGCCGCCTGGCTCACCTGGAGCCTCTATCAGCGTGAATCCTTCGTC
GGCCTCCAGGCGGGGCTGGGCATGCTTCGCTACCTCTGCAGCGAACGCTGGGAAACCCTCTTCCCGCAAA
AATCCCGCACCCGCATAGCGGCCTTCACCTGGCTCATACCACGCATGGAACAGGCGGTGGCCGAGCATGT
GGCGATTGGCGAGCAGCTGGGGCTGTTCACCCGGATGGCTGAAGATCTGCGCGCGCTGGATGCCTGCCTG
AGGGAGCATCTGGGCGAAGAAAGCGCACCTCTGCTGCTGCCGCTCGGCCGGCGCCTGGAAGAGATGGTCA
AGCGGGCCAGCCAGGGGCAACCACAACCGGGGCCCATCGAGAACGCCATCGCCCAGGTCAAACAGGTCTT
CAACACCTCGCCTACCGTCGAAAACGAAAAGGACGCGCACAAGCAGTTGCGCGTCTTGCAGGACCAGGCA
CGCCCGCTGTGCAGCTGGTGGCTCAAGCAGAAAACCACCGACATCAAGCCGCTGCGCCTGACGCGCACCC
TGCTCTGGCTACCGATCGACAGCCTGCCGGAGCGCAATGCCGAACAGATCACCGCCTTGCGCGGCATCCC
GGCCGACAAGCTGGCCAGCTACCGGGAACGCTTTTCCCAGGGGCTGTATGCCGATCTGCTGGTGGATCTG
GAAGCCAGCACCGCCCGCGCGCCCTTTTGGCTGGACGGCCAGCGCCTTGCCTGGGAGTGCCTGCAGGAAC
TGAACGCCGACCTGGCGATGCGTGAACTCGAGATCCAGCTCGCGCTGTTTCTGAAACGCCTGCCCGGACT
CGACGAATTGCGCTTTCACGACGGAACCCCGTTCGCCGATGCCGAAACCCGCGCCTGGATCAGCGCTCAG
GTGTTGCCGACCCTGGATCCGGCGCCAGCAACCAGCGAACCAGACAGTATCCAGAACGGCACCACGCCGA
CCTGGGAAGAAGCCCTGCAGAACGTACTGCCGCAACTGCGCAAGGACGGACTCAAGCCCGCCGTGCAGCA
ACTCAAGAAAGGACTCGCCACCGCGCGAGGCGGCCGCGAGCGTTTTTTCTGGCAACTCACCCTGGCCCGG
CTCTGCTATCAGGCCAAGAAATACGAGCTGGCGAAGACCCAGCTGGAAACCCTCGACCAGACCCTCAAGG
CCACTGGCCTTGCCGACTGGGAACCCGATCTCGCCCTGGAAATTCTGCGTCTGCTGCACAGCTGTTGCGA
GCTGCTGCCGCAAAACCACGCCACGCGTGAAAGCAAGGATGAGATCTACCGCAGGCTGTGCCACCTCGAC
CTCGAAGTGGTGCTGGATTAA
 Primer design