SecReT6
Protein ID: 397685915
SecReT6 ID682
T6SS typeN/A
Gene symbol-
Locus tagPSJM300_03990
StrainPseudomonas stutzeri DSM 10701
Repliconchromosome [GenBank: NC_018177] [Browse all T6SS(s) in this replicon]
Location [Strand]882640..886179 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDI7AAE3
KEGG IDpsj:PSJM300_03990
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.50E-79, Aligned region: 502..793
ImcF-related_N [PF14331], Evalue: 3.20E-73, Aligned region: 197..456
DUF1215 [PF06744], Evalue: 5.30E-36, Aligned region: 280..310
DUF1215 [PF06744], Evalue: 5.30E-36, Aligned region: 743..770
DUF1215 [PF06744], Evalue: 5.30E-36, Aligned region: 916..1038
AAA_33 [PF13671], Evalue: 0.00022, Aligned region: 135..267
Protein Sequence: 1179 a.a.     [Download]
>gi|397685915|ref|YP_006523234.1| type VI secretion protein IcmF [Pseudomonas stutzeri DSM 10701]
MKVFFAKLGAFFRKTWVWSLCLVLMAALLVWFAGPLFAVDDHKFWESATSRLLTISTLFLIWGLAMVFAS
WRATIRRKKEEDDQDVQEKLRRDGAIGEEQQELRHRFKQALRTLRSSSLYRGRSEKWRNELPWYLLLGPQ
GSGKTSLLDFSGLDFPLNRGENQRLTKDVSGTRYADWYFADHAVLIDTAGRYLTQPDAQIDRSAWDTLLG
LLRKRRARPLNGVLVNIPVELLLGDNELELENLARQTRQRLHEIHQRLAVDVPVYLVLSKADRILGFEEF
FDQLSREESDQVLGVSFRQQQKGAEAQVVRQEFEELLRRLNSQVILRMHQERDTQRRGRILDFPHQLGQI
GERLGLFIELAFAGNRYQRASQLRGFYLTSAPQLQDSLDPLTAGIGRSIGLAGSALPTFRSGRARFINQL
LSRVIFPEAELAGLDQREVRRIDWRQRALYAAAFACMALFGLGWALNFSGNHDRLEQLREIAQALGQQRQ
AIEPQDDALQTLKTLDSSYAATQVFPPRDEVSWLRRGGLYQGEQVDPTLHQAYRRELEALLLPRVGRQLE
AQIRANLDDRERLLGSLRAYLMLQLEQRRDADYLKDWVAADWSLRYAGNGIAQNGLNGHFARLLEESFAP
YPLNEQLVAQARTQLRSESLANVVYRMLREQARSLPDYRLSQRLGPQASQFIGSDYPVPGFYTQRGYQRM
FVAQGADLVREILRDNWVLGEGESLSAKDLSRLMVEMEQLYFRDYANHWSEALAQLNLQPANTAAEGALQ
LAGLTAANSPLLQLLVEIRENTRFSGLAEAADQAGEAAEAAQAAGGKLGKAGKLAAVAAEQAQAALLRNL
PDTARKALERRFEPLHRLLDEAGGAGPELASALQALDALHRQLTGLAHASAPEQAAFEMARARMAGQPDA
INQVHSSAGRLPQPVGKWLGLLAEDSWMLVLSDAYHYLNQRYRSELYAAYGGSLRQRYPFNAHSESDVAL
ADFREFFKAQGTADSFFDRYLKPFVTGSAGQYRLRRVDGRGLPLSEEFLAQMGRAQTIRRSFFTENPNEP
LILFKLEPYSLDSSLGRADFRFGKQQMEYRHGPIVQTAFRWPAEGDEGRTSLVVEELGGRRVGIEKNTGP
WSLFRLLDLMEVDYHSGRDVLMLKANLGGLRANYLLHSQRSPNPFDIDLLRGFKLPTTL
 
Nucleotide Sequence: 3540 bp     [Download]
>gi|397685123|ref|NC_018177.1|:882640-886179 Pseudomonas stutzeri DSM 10701 chromosome, complete genome
ATGAAGGTTTTCTTCGCCAAGCTCGGCGCCTTTTTTCGCAAGACCTGGGTCTGGAGCCTGTGTCTGGTGC
TAATGGCCGCGCTGCTGGTCTGGTTTGCCGGCCCGCTGTTCGCGGTCGACGATCACAAGTTCTGGGAATC
GGCCACCAGCCGCCTGTTGACCATCAGCACGCTGTTCCTGATCTGGGGGCTGGCCATGGTGTTCGCCAGC
TGGCGTGCCACGATTCGCAGGAAAAAGGAAGAAGACGACCAGGACGTCCAGGAAAAGCTGCGACGCGATG
GGGCGATCGGTGAAGAACAGCAAGAGCTGCGCCATCGTTTCAAGCAGGCGCTGCGTACGTTGCGCAGTTC
CAGCCTGTATCGCGGGCGCAGTGAAAAATGGCGCAACGAGTTGCCCTGGTACCTGCTGCTCGGTCCTCAG
GGGAGTGGCAAGACCAGTCTGCTGGATTTCTCCGGGCTGGATTTTCCGCTGAACCGTGGCGAGAACCAAC
GCCTGACCAAGGACGTATCCGGCACTCGCTACGCGGACTGGTATTTCGCCGATCACGCCGTGCTGATCGA
CACGGCCGGCCGCTACCTGACCCAGCCTGATGCGCAAATCGACCGCAGTGCCTGGGACACCCTGTTGGGC
CTGCTACGCAAGCGGCGCGCCCGTCCGCTCAATGGCGTGCTGGTGAACATCCCGGTGGAGCTGTTGCTGG
GCGACAACGAACTCGAACTGGAGAACCTGGCCCGTCAGACGCGGCAGCGACTGCACGAAATCCATCAGCG
TCTGGCCGTCGACGTGCCGGTGTACCTGGTCTTGAGCAAGGCCGACCGTATCCTCGGCTTCGAAGAGTTC
TTCGATCAGCTGTCACGCGAAGAAAGCGACCAAGTGCTCGGTGTCAGTTTCCGCCAGCAACAGAAGGGGG
CCGAGGCCCAGGTCGTGCGCCAGGAGTTCGAGGAGCTGCTGCGCCGCCTCAACAGCCAGGTCATTTTGCG
CATGCACCAGGAGCGCGATACCCAGCGCCGTGGGCGAATCCTCGACTTCCCTCATCAACTGGGACAGATA
GGCGAACGCCTCGGTCTGTTCATCGAACTGGCCTTCGCCGGTAATCGCTACCAGCGCGCCAGCCAGCTAC
GCGGCTTCTACCTGACCAGCGCACCGCAACTGCAGGACAGCCTCGATCCGCTGACCGCCGGTATCGGACG
CAGCATCGGCCTGGCCGGAAGCGCTCTGCCCACCTTCCGCAGCGGCCGCGCTCGGTTCATCAACCAACTG
CTGAGCCGCGTGATTTTTCCCGAAGCCGAACTGGCCGGGCTCGACCAGCGCGAAGTACGGCGCATCGATT
GGCGTCAGCGTGCGTTGTACGCCGCAGCCTTCGCTTGCATGGCGCTGTTCGGCCTGGGCTGGGCGCTGAA
TTTCTCCGGTAACCATGATCGGCTCGAACAGCTACGCGAGATCGCCCAGGCGCTCGGCCAGCAGCGCCAG
GCCATCGAACCGCAGGACGATGCGCTGCAGACCCTCAAGACGCTCGACAGCAGTTATGCCGCCACCCAGG
TCTTTCCGCCCAGGGATGAGGTTTCCTGGCTGCGTCGCGGTGGCTTGTACCAGGGTGAGCAGGTCGATCC
GACGCTGCACCAGGCCTACCGCCGTGAACTGGAAGCGCTGCTGTTGCCACGTGTCGGACGCCAGCTGGAA
GCGCAGATACGGGCCAACCTGGATGACCGTGAGCGTCTGCTCGGCAGCCTGCGTGCCTACCTGATGCTGC
AGCTGGAGCAACGCCGCGACGCCGACTATCTCAAGGATTGGGTCGCCGCGGACTGGTCACTGCGTTATGC
CGGTAACGGCATCGCCCAGAACGGATTGAACGGCCATTTCGCACGCCTGCTGGAGGAGTCGTTCGCACCC
TATCCGCTGAACGAGCAGCTGGTCGCGCAGGCACGTACGCAACTGCGCAGCGAATCGCTGGCCAACGTCG
TCTATCGCATGCTTCGCGAGCAGGCTCGCAGCCTGCCGGATTACCGTCTGAGCCAGCGCCTCGGCCCGCA
GGCGTCGCAGTTCATCGGCAGTGATTATCCGGTTCCCGGCTTCTATACCCAGCGCGGCTATCAACGGATG
TTCGTCGCCCAGGGGGCGGATCTGGTGCGGGAGATCCTGCGCGACAACTGGGTACTGGGCGAGGGCGAGA
GCCTCAGCGCCAAGGACCTGAGCCGTTTGATGGTGGAGATGGAGCAACTCTATTTCCGCGACTACGCCAA
CCATTGGAGCGAAGCACTGGCGCAGCTCAACCTGCAGCCGGCCAATACGGCTGCTGAAGGCGCGCTGCAA
CTGGCCGGTCTGACGGCTGCCAACTCGCCGTTGCTGCAGTTGCTGGTGGAAATACGCGAGAACACTCGCT
TCAGCGGCCTTGCTGAAGCGGCCGATCAGGCTGGAGAGGCAGCTGAAGCGGCCCAGGCCGCAGGCGGCAA
ACTTGGGAAGGCCGGCAAGCTGGCTGCCGTCGCCGCGGAACAGGCGCAGGCCGCATTGCTCAGGAACCTG
CCTGATACTGCACGCAAGGCCCTGGAGCGACGCTTCGAACCCTTGCATCGCTTGCTCGATGAAGCGGGCG
GCGCCGGCCCCGAGCTGGCCAGCGCGCTTCAGGCACTGGATGCGCTGCATCGGCAACTGACCGGCCTGGC
GCATGCCAGTGCGCCGGAACAGGCTGCGTTCGAGATGGCCCGTGCCCGTATGGCTGGCCAGCCTGATGCG
ATCAACCAGGTGCACAGCAGCGCCGGACGCCTGCCGCAGCCGGTTGGAAAGTGGCTCGGGCTGCTCGCTG
AAGACAGCTGGATGCTGGTCCTCAGCGATGCCTACCACTACCTCAACCAGCGTTATCGCAGCGAGCTGTA
CGCCGCCTACGGTGGCTCGCTGCGCCAGCGCTATCCATTCAATGCGCACAGCGAAAGCGACGTTGCGCTC
GCCGACTTCCGCGAGTTCTTCAAGGCGCAGGGCACCGCCGACAGCTTTTTCGATCGTTACCTGAAGCCTT
TCGTCACCGGCAGTGCAGGCCAGTATCGTCTGCGTCGTGTCGATGGCCGCGGTCTGCCGCTGTCCGAGGA
GTTCCTGGCACAGATGGGCCGGGCGCAGACCATTCGGCGCAGCTTCTTCACGGAAAATCCCAACGAGCCG
CTGATTCTGTTCAAGCTGGAACCCTATTCGCTGGATTCCAGCCTTGGTCGGGCGGACTTCCGCTTCGGCA
AGCAGCAGATGGAATACCGTCACGGGCCGATCGTGCAGACGGCATTCCGCTGGCCGGCCGAGGGCGACGA
AGGACGCACCAGTCTGGTGGTCGAGGAGCTGGGTGGCCGGCGTGTCGGCATCGAGAAGAACACCGGCCCC
TGGTCGCTGTTCCGTCTGCTCGATCTGATGGAGGTGGACTACCACAGCGGTCGCGATGTGCTGATGCTCA
AGGCCAACCTCGGTGGGCTGCGCGCCAACTATCTGCTGCACAGCCAGCGTTCGCCGAACCCCTTTGATAT
CGACCTGCTGCGCGGCTTCAAACTGCCGACGACACTGTGA
 Primer design