SecReT6
Protein ID: 397685916
SecReT6 ID682
T6SS typeN/A
Gene symbol-
Locus tagPSJM300_03995
StrainPseudomonas stutzeri DSM 10701
Repliconchromosome [GenBank: NC_018177] [Browse all T6SS(s) in this replicon]
Location [Strand]886190..886921 [+]
Productserine/threonine phosphoprotein phosphatase Stp1
NoteStp1
UniProt IDI6Z1S0
KEGG IDpsj:PSJM300_03995
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.80E-17, Aligned region: 20..229
PP2C [PF00481], Evalue: 4.00E-16, Aligned region: 29..210
SpoIIE [PF07228], Evalue: 7.80E-11, Aligned region: 36..242
Protein Sequence: 243 a.a.     [Download]
>gi|397685916|ref|YP_006523235.1| serine/threonine phosphoprotein phosphatase Stp1 [Pseudomonas stutzeri DSM 10701]
MSEVASAWRSAARTDTGKVRARNEDAFLDLPERELWVVADGMGGHQNGALASRLIVEALAELPHERGLEQ
RVAQIRGCLHELNRRLGQDLTLACGQADSLMGSTVVVFLAEDDRAACIWAGDSRCYLWRSSRLYQLSRDH
SLAQLLIEEQQMSAEEAARHPRAHALTRAVGACEALQLDIVELDVLPGDALLLCSDGLYQSLSPDQLGAA
LNLGSAPLALRRLFDQALQGAARDNLSAIVIRR
 
Nucleotide Sequence: 732 bp     [Download]
>gi|397685123|ref|NC_018177.1|:886190-886921 Pseudomonas stutzeri DSM 10701 chromosome, complete genome
ATGAGCGAAGTCGCGAGCGCCTGGCGCAGTGCCGCACGCACCGACACCGGCAAGGTTCGGGCGCGCAACG
AGGATGCCTTCCTCGATCTGCCCGAGCGCGAGCTATGGGTGGTCGCCGATGGCATGGGTGGCCACCAGAA
TGGCGCATTGGCCAGCCGGCTGATCGTCGAAGCGCTGGCCGAGCTGCCTCACGAGCGGGGGCTGGAGCAG
CGCGTGGCCCAGATACGTGGTTGCCTGCATGAGCTCAACCGCAGACTCGGCCAGGATCTGACCCTAGCTT
GCGGCCAGGCCGACAGCCTGATGGGCAGCACCGTCGTGGTGTTTCTGGCCGAGGATGATCGCGCTGCCTG
CATCTGGGCCGGCGACAGTCGCTGTTACCTCTGGCGCAGCAGTCGCCTGTATCAACTCAGCCGGGATCAT
TCGCTGGCCCAGTTGCTGATCGAGGAGCAGCAAATGAGCGCTGAGGAGGCGGCCCGCCATCCCCGCGCGC
ACGCCTTGACCCGCGCAGTGGGAGCCTGCGAAGCGCTGCAACTGGATATCGTCGAGCTCGACGTTCTGCC
CGGTGACGCCTTGCTGCTCTGCAGCGACGGTCTCTACCAGAGTCTGTCACCCGATCAGTTAGGCGCGGCG
CTGAACCTCGGTTCGGCACCGCTGGCCCTGCGGCGGCTATTCGACCAGGCGCTGCAGGGCGCCGCGCGGG
ACAACCTCAGCGCGATAGTGATTCGTCGGTGA
 Primer design