SecReT6
Protein ID: 397685917
SecReT6 ID682
T6SS typeN/A
Gene symbol-
Locus tagPSJM300_04000
StrainPseudomonas stutzeri DSM 10701
Repliconchromosome [GenBank: NC_018177] [Browse all T6SS(s) in this replicon]
Location [Strand]886931..887896 [+]
Productserine-threonine kinase Stk1
NoteStk1
UniProt IDI7A6I0
KEGG IDpsj:PSJM300_04000
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 6.10E-37, Aligned region: 41..269
Pkinase_Tyr [PF07714], Evalue: 2.40E-24, Aligned region: 42..294
APH [PF01636], Evalue: 6.80E-06, Aligned region: 125..193
APH [PF01636], Evalue: 6.80E-06, Aligned region: 210..265
Protein Sequence: 321 a.a.     [Download]
>gi|397685917|ref|YP_006523236.1| serine-threonine kinase Stk1 [Pseudomonas stutzeri DSM 10701]
MSEQVLASDQTYFAFAESASSSPAQARQPLKALPDVLCGRYKIERLLGVGGMGAVYRGRDLLREQLGDPA
PFVALKALSDEFAEYADGNALLHGEFAMTVRLHHRHIVRCHSFELDRGSERAFIVMEQLRGCTLDHLLLR
YPQGLPWAEAREISLALLEALAYAHTQGVLHGDIKPGNLMLDDGNIRLFDFGLGRIVGDDEASVPILARS
RFCAWTPRYAAPELIDGGALSMATDIYAVACVIYELCHGQHPYRRLSAKQAQGMSLALAAPTGMPAPVWK
VLKRGLAFDVAKRSDSLEPLLAAFRANPASPRFGRWFGRRA
 
Nucleotide Sequence: 966 bp     [Download]
>gi|397685123|ref|NC_018177.1|:886931-887896 Pseudomonas stutzeri DSM 10701 chromosome, complete genome
ATGAGCGAGCAAGTGCTGGCTTCGGATCAGACCTATTTCGCCTTTGCCGAATCGGCTTCGTCGAGCCCAG
CGCAAGCGCGCCAACCGCTCAAGGCGCTGCCCGATGTGCTGTGTGGACGCTACAAGATCGAGCGCCTGCT
GGGCGTCGGCGGCATGGGCGCGGTCTATCGAGGGCGCGATCTGCTCCGCGAGCAGCTGGGGGATCCCGCT
CCCTTCGTGGCGCTGAAAGCCTTGAGCGATGAGTTCGCCGAGTACGCCGACGGCAATGCGCTGCTGCATG
GTGAATTCGCCATGACGGTCCGCCTGCATCATCGGCACATCGTGCGTTGCCACAGTTTCGAGCTCGATCG
GGGCAGCGAGCGTGCCTTCATCGTCATGGAGCAGCTCAGGGGCTGCACGCTGGACCATCTGCTGTTGCGC
TATCCACAGGGGTTGCCTTGGGCCGAGGCGCGAGAAATCTCCTTGGCACTGCTGGAAGCGCTGGCCTATG
CCCACACGCAGGGTGTGCTGCATGGCGATATCAAGCCCGGCAACCTGATGCTCGACGATGGGAACATCCG
ACTGTTCGATTTCGGCCTGGGTCGAATCGTCGGGGATGACGAGGCGAGCGTGCCGATACTGGCGCGAAGC
CGCTTCTGCGCCTGGACGCCACGTTATGCCGCGCCGGAACTGATCGATGGTGGCGCGCTGAGCATGGCCA
CGGATATCTATGCGGTCGCGTGCGTTATCTACGAGTTGTGCCACGGTCAGCATCCCTATCGGCGATTGAG
CGCCAAGCAGGCGCAGGGCATGAGCCTGGCGTTGGCGGCGCCAACCGGTATGCCGGCTCCCGTCTGGAAG
GTTCTCAAGAGGGGACTGGCGTTCGATGTTGCCAAGCGCAGTGACAGCCTTGAGCCGTTGCTGGCTGCGT
TTCGCGCCAATCCCGCATCTCCCCGTTTCGGCCGCTGGTTCGGCCGCCGTGCATGA
 Primer design