SecReT6
Protein ID: 397692827
SecReT6 ID683
T6SS typei1
Gene symbol-
Locus tagT1E_0057
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]60496..64122 [+]
Producthypothetical protein
NoteTssM
UniProt IDI7BYK3
KEGG IDppx:T1E_0057
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.50E-87, Aligned region: 526..833
ImcF-related_N [PF14331], Evalue: 4.90E-68, Aligned region: 219..479
ImcF-related_N [PF14331], Evalue: 4.90E-68, Aligned region: 732..750
DUF1215 [PF06744], Evalue: 1.50E-29, Aligned region: 930..1051
DUF998 [PF06197], Evalue: 0.0019, Aligned region: 18..83
DUF998 [PF06197], Evalue: 0.0019, Aligned region: 472..486
Protein Sequence: 1208 a.a.     [Download]
>gi|397692827|ref|YP_006530707.1| hypothetical protein T1E_0057 [Pseudomonas putida DOT-T1E]
MNQLWKYLKRWGWPLMTRIGLAMPLLLGLGAVLMLVAIWWLGPQWTWRDQQPLASVAHRSVASLVFVLVA
LLCWLIVLRTRFRRLQAERQQAMAAEVDPAQPFVHAQEKALSQALARYLDNAGGRRALYRLPWYLVLGAR
QAGKSSFIDCTDQSFSLTRIDKAQARGRPAQALAYPVGWWISNDAVIIDPPGAFISQTGLVDSLGSDSTD
VESSVPPGTQAKLWQHLLGWLQRNRSQRALNGLVLVVDLPALLHGTVEQRTALAHLLRTRLYEASSQLGS
RLPLYVVLSKFDLLDGFDPFYSKLSAAKRNSLFGFTFKLDAVDTFDAWLGEYGEHYDRLLEQLFEQVIDH
LDVQGSPGLRSRLYSLHRQFLGLRPILLSFLRETLASDRFTTPALVRGVYWSSVVQHGDVRNAFVREAAQ
PYKTSLPLLEGKPQAKALAYFIQQAFGRVIYKEAGLAGDNVRVARRKRQLLWVGASVGVLAFCVAIASWH
RYFDINGVKAASVLAKSREYSHHEVDQRLDPTGRNLLAPLDQIRDAVAVFGDYRAAWPGVADLGLYQGRA
IGPTVDEAYLSLLSRRFLPALASGVIDTMDAAPPGSEQQMAALRVYRMLEDRRNRRAEWVEDWMARQWQQ
AFPGQGQLQRDLMQHLKYALAYADTDLPQYRQRVSDVQQTLRKVPLPQRVYAGLKQQAQEQLHTGLDLRH
QVGPAFDVVYQPSSGSSQGDNGVLLAAMLTAKGFKEYFEPRSQRFTEMAMIDQWALGERAQLDYSDADQA
ALNERLRNLYSADYIDSWRRALNAFSVADFRDLDHGVTILEQLAGPAAPVYRLLETVRDNSSLSSPVNVG
VADEAPSLVSVNSKPEQQHALAIQRAFAGLSAMLHAAGEKPSYYDEMHAAIAAVHDYAKAIQGSPDRGKA
ALHAVHQRFSMTGHDPIGTLQRIATGLPEPINHHVRKVAEQTAQVLNVEALRELERRWDAEVYSFFQQRL
AERYPFVVRAPDASLEDFEAFFGPKGRLQHFQDQYLKLFLKDNLEALQAGLQGRSLIRPDVIEQLALADR
IRETFFDQRGNLSVQFSIEPLGLSANQRTSLLDLDGQLISYTHGPSQITGIVWPNTLGQHVRSNLTLLRQ
NGNSSSLEYRGPWSMFRLLSRGALNGRTATSVDLSFKTGDGVMRYRLNAEKAFNPITQQPFKGFRLPRGL
LQQPARVALVEQADVPVM
 
Nucleotide Sequence: 3627 bp     [Download]
>gi|397692770|ref|NC_018220.1|:60496-64122 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGAATCAACTCTGGAAGTACCTCAAACGTTGGGGCTGGCCGCTGATGACCCGTATCGGTCTGGCAATGC
CGCTGCTACTTGGGCTTGGCGCTGTGCTGATGCTGGTCGCCATCTGGTGGCTCGGCCCGCAATGGACGTG
GCGCGATCAGCAGCCGTTGGCCAGTGTGGCGCATCGTAGTGTGGCCAGCCTGGTGTTCGTGTTGGTGGCG
CTGTTGTGCTGGCTGATCGTGTTGAGAACGCGCTTTCGCCGGTTGCAAGCAGAGCGTCAGCAGGCGATGG
CTGCCGAGGTGGATCCGGCGCAACCGTTCGTTCATGCACAAGAGAAGGCGTTGAGCCAAGCGCTTGCACG
CTACCTGGACAATGCCGGTGGGCGTCGCGCGCTGTACCGATTGCCGTGGTACCTCGTGCTGGGCGCCAGG
CAGGCCGGCAAGAGCAGCTTTATTGACTGCACCGATCAAAGTTTCTCGTTGACCCGCATCGACAAGGCGC
AGGCACGGGGCCGGCCAGCGCAGGCGCTCGCCTACCCCGTGGGGTGGTGGATCAGCAATGATGCGGTGAT
CATCGACCCGCCCGGTGCCTTTATCAGCCAGACCGGCCTCGTAGATTCGCTGGGCAGTGACTCCACAGAC
GTTGAGTCTTCGGTACCGCCTGGAACCCAAGCCAAATTGTGGCAGCATCTGTTGGGCTGGCTGCAGCGCA
ATCGAAGCCAGAGAGCCCTCAACGGCCTGGTGCTGGTTGTCGACCTGCCCGCGCTACTGCACGGTACCGT
CGAGCAACGCACGGCACTTGCCCACCTGCTGCGCACACGTCTTTATGAGGCGAGCAGCCAGTTGGGCTCG
CGCTTGCCGCTGTATGTCGTGTTGAGCAAATTCGATCTGCTGGACGGCTTCGACCCATTCTACAGCAAGC
TTTCGGCCGCCAAGCGCAACAGCCTGTTTGGATTCACGTTCAAGCTGGATGCCGTCGACACCTTCGACGC
TTGGCTGGGCGAGTATGGCGAACATTACGATCGGTTGCTGGAGCAGCTGTTCGAGCAGGTGATCGATCAT
CTGGACGTGCAGGGTAGCCCTGGGTTGCGCTCACGTCTCTACTCACTGCATAGGCAGTTCCTTGGGTTGC
GTCCAATCCTGTTGAGCTTTCTGCGCGAGACCTTGGCAAGTGACCGTTTCACCACCCCGGCGCTGGTGCG
CGGTGTGTATTGGTCGTCGGTCGTACAGCACGGTGACGTGCGCAACGCCTTTGTCCGTGAGGCGGCGCAG
CCTTACAAGACCAGCCTCCCCTTGCTTGAGGGCAAGCCGCAGGCCAAGGCGTTGGCCTACTTCATTCAAC
AGGCCTTTGGGCGGGTCATCTACAAAGAGGCCGGCCTTGCCGGCGACAACGTCAGGGTGGCACGGCGCAA
GCGACAATTGCTGTGGGTGGGTGCTTCTGTAGGCGTCCTGGCCTTCTGCGTCGCCATCGCCAGCTGGCAT
CGTTACTTCGACATCAATGGCGTCAAGGCCGCCAGCGTGCTGGCCAAGAGCCGGGAATACAGCCATCACG
AAGTGGATCAGCGTCTGGACCCGACCGGGCGCAACTTGCTGGCGCCGCTGGACCAGATCCGCGATGCGGT
AGCAGTGTTTGGCGACTACCGCGCTGCGTGGCCGGGTGTTGCTGATCTGGGGCTGTATCAGGGCCGTGCC
ATCGGGCCGACCGTGGATGAGGCGTACCTCAGTTTGTTGTCCAGGCGCTTCCTGCCTGCGTTGGCCAGTG
GCGTGATCGATACCATGGATGCGGCGCCCCCCGGCAGCGAGCAGCAAATGGCCGCGCTCCGGGTTTACCG
GATGCTCGAGGATCGCCGGAACCGCCGAGCGGAATGGGTCGAGGACTGGATGGCGCGACAGTGGCAACAG
GCCTTCCCCGGCCAGGGGCAGCTGCAACGTGACCTCATGCAGCACCTGAAGTATGCCCTGGCCTACGCGG
ATACCGACCTGCCGCAGTATCGCCAGCGGGTCAGCGACGTGCAGCAGACCCTGCGTAAGGTGCCGTTGCC
ACAACGCGTGTATGCGGGCCTGAAGCAGCAGGCCCAGGAGCAGTTGCATACTGGTCTGGACCTGCGTCAT
CAGGTGGGGCCTGCGTTCGATGTCGTTTACCAGCCGTCTTCCGGCTCGAGCCAGGGCGACAACGGTGTTT
TGCTGGCGGCCATGCTCACCGCCAAAGGCTTCAAGGAGTATTTTGAACCGCGTAGTCAGCGCTTTACGGA
AATGGCAATGATCGACCAGTGGGCACTGGGGGAACGTGCTCAACTGGACTACTCCGATGCCGACCAGGCT
GCGCTGAACGAGCGCCTGCGCAACCTGTACAGCGCCGACTACATCGACAGCTGGCGCCGCGCCTTGAACG
CATTCTCCGTGGCGGATTTTCGAGACCTGGATCATGGCGTCACGATCCTTGAACAGTTGGCCGGGCCAGC
GGCGCCGGTGTACCGATTGCTGGAGACGGTTCGCGACAACAGTTCGCTGTCATCACCGGTGAATGTTGGC
GTGGCGGATGAGGCCCCCTCGCTTGTTTCGGTCAACAGCAAGCCCGAGCAACAACACGCGCTGGCCATCC
AGCGGGCGTTTGCAGGCTTGAGCGCCATGTTGCACGCTGCAGGCGAAAAACCGAGCTACTACGATGAAAT
GCACGCAGCCATAGCTGCCGTCCACGACTATGCCAAGGCGATACAGGGTAGCCCAGACCGGGGCAAGGCC
GCGCTGCACGCGGTGCATCAGCGCTTTTCAATGACCGGGCACGACCCCATCGGCACCTTGCAACGCATCG
CCACTGGCTTGCCGGAGCCAATCAACCATCACGTCAGAAAGGTGGCAGAGCAAACGGCGCAAGTGCTGAA
CGTTGAAGCGCTGCGCGAGCTGGAGCGACGGTGGGATGCTGAAGTCTACAGCTTCTTCCAGCAGCGCCTG
GCCGAGCGCTACCCATTCGTCGTCAGGGCACCCGACGCTTCGCTGGAAGACTTTGAAGCGTTCTTCGGAC
CGAAGGGGCGACTGCAGCATTTCCAGGATCAATACCTGAAGCTTTTCCTCAAGGACAATCTGGAAGCCTT
GCAGGCTGGTCTGCAGGGGCGTTCCCTGATCCGTCCCGATGTGATCGAGCAGCTGGCACTGGCTGATCGC
ATCCGCGAAACGTTCTTTGATCAGCGCGGTAACCTCAGCGTGCAGTTCAGCATCGAGCCTTTGGGGCTCA
GTGCAAATCAACGCACCAGCCTGCTGGATCTGGATGGCCAGCTGATTTCCTACACCCACGGCCCAAGCCA
GATCACCGGCATTGTCTGGCCCAATACCTTGGGGCAACACGTGCGCAGCAACCTGACCCTGCTCAGGCAG
AACGGCAATAGCAGCAGCCTGGAGTATCGAGGGCCTTGGTCGATGTTCCGCCTGCTCAGCCGCGGTGCGC
TCAATGGACGTACGGCAACCAGCGTGGACCTGAGCTTCAAAACGGGTGATGGTGTGATGCGCTATCGGCT
GAACGCGGAAAAGGCCTTCAACCCAATTACTCAACAACCGTTCAAAGGTTTTAGGTTGCCCCGAGGGTTG
TTACAACAGCCAGCCAGGGTGGCGTTGGTCGAACAGGCGGATGTGCCTGTCATGTAA
 Primer design