SecReT6
Protein ID: 397693178
SecReT6 ID684
T6SS typei1
Gene symbol-
Locus tagT1E_0408
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]462045..465665 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDI7BQ86
KEGG IDppx:T1E_0408
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.50E-84, Aligned region: 110..154
IcmF-related [PF06761], Evalue: 3.50E-84, Aligned region: 524..831
ImcF-related_N [PF14331], Evalue: 4.10E-69, Aligned region: 218..476
DUF1215 [PF06744], Evalue: 9.90E-30, Aligned region: 928..1049
Protein Sequence: 1206 a.a.     [Download]
>gi|397693178|ref|YP_006531058.1| ImcF domain-containing protein [Pseudomonas putida DOT-T1E]
MNQIWTQLKRWGWPWVTRIGLALPLLLGLGALLMLVAIWWLGPQWTWREQQPLASVAHRSVASLVLVLVP
LLCWLGVLRTRFRRLQAERRQVLAAEQDVALPFVQAQERALSQGLERYLDNAGGRRALYRLPWYLVLGDE
QSGKSSFIDRTDQRFTLTRIDQAQARGRQAEALAYPVGWWVSDDAVIIDPPGVFISQKPPVGSAANDPTN
ASAPPGIQARLWEHLLGWLQRKRSQRALNGVLLVVDLPALLHGKPEQRVALAHGLRTRLYEVSSQLGARL
PLYVVLTKFDLLDGFDQFYSQLPAAKRESLLGFTFKLDAVDAFDAWLDEYDEHYGRLLTQLHEQVIDRLD
VLGKTAPCVRLFSLHAQLIGLRPILQAFLRETLASDRFTTPPLVRGVYWSSVVQQGDMRNAFVREAAQPY
TTKLPLREGKAQGKALVYFIQQAFRRVIYQEAGLAGDNVRVARSKRHLLWVGSGVGILAFSIAIASWQRY
AEINGAKAASVLAKSQEYGGHEVDMRLDPTGRNLLAPLDQIRDAVAVFGDYRAAWPVVADFGLYQGRNIG
PLVDEAYLSLLSKRFLPALASGVIDAMNAAPPGSEQQMAALRVYRMIEDRNSRRPEWVEDWMARQWQRAF
PGQGQLQRDLMQHLKYALAYADTDLPQYRQRVSEVQQALRKLPLPQRVYAGLKQQSYEQVHAGLDLRHQV
GPAFDVVYQPSSGSRQGGEDVRLAGMLTAKGFRDYFEPHSQRFAEMAMVDQWALGERSQLDYSDVDRDAL
TERLYNLYSADYIDSWRRALNAFTVADFRDLDHGVAILEQLTGPAAPLQRLLDTVRDNTSLASPAVVESP
GELSTLRVATGKPEQQQALAIQRAFAGLGAMLQATGEKPSYYDETLGAVAAVLDYAKAVQDSPDRGKAAL
QAVHQRFAMTGQDPIGTLQRVATGLPEPISHQVRKLADQTAQVLNVEALRELERRWDADVYSFFQQRLAG
RYPFVVKAPDASLDDFEAFFGPKGRLQQFNDRYLKVFLKDNLEALQSAQHGQSLIRADVIEQLELAERIR
ETFFDQRGQLSVQFSIEPLGLSANQRTSLLDLDGQLIAYTHGPSHITGIVWPNTLGQQVRSNLTLLRQNG
NSSSLEYRGPWSMFRLLSRGALNGRTATSVDLSFRTGDGVMRYRLNAEKAFNPITQQPFKGFRLPRGLLQ
QPANGVQAALSYEQRL
 
Nucleotide Sequence: 3621 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c465665-462045 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGAATCAAATATGGACGCAACTCAAACGTTGGGGCTGGCCGTGGGTAACGCGCATTGGCCTGGCGCTGC
CGCTGCTGCTAGGGCTTGGCGCCTTGCTGATGCTGGTCGCTATCTGGTGGCTTGGCCCGCAATGGACGTG
GCGGGAGCAGCAGCCGCTGGCAAGTGTGGCTCATCGCAGCGTGGCAAGCCTGGTGCTCGTGCTGGTGCCG
CTTCTGTGCTGGCTTGGGGTGCTGCGCACGCGCTTTCGCCGCCTGCAAGCGGAGCGCCGGCAGGTACTGG
CCGCCGAACAGGATGTCGCGCTACCGTTCGTGCAGGCGCAAGAGCGGGCCTTGAGCCAGGGGCTTGAGCG
GTATCTCGACAATGCCGGTGGGCGACGCGCGTTGTACCGGCTGCCTTGGTACCTGGTGTTGGGCGACGAA
CAGTCCGGTAAAAGCAGCTTCATCGACCGCACCGATCAGCGCTTTACCCTGACGCGTATCGACCAGGCCC
AGGCACGGGGCCGACAGGCTGAAGCACTGGCCTATCCGGTAGGCTGGTGGGTCAGCGACGATGCCGTGAT
CATCGACCCGCCCGGCGTTTTCATCAGTCAAAAACCACCGGTGGGCTCGGCGGCCAACGACCCCACCAAT
GCCTCCGCGCCGCCCGGCATCCAGGCCCGGTTATGGGAGCACCTGTTGGGCTGGCTGCAGCGTAAGCGAA
GCCAGCGGGCGCTCAATGGTGTGTTGCTGGTGGTCGACCTGCCGGCGCTGCTGCATGGCAAGCCCGAGCA
GCGCGTCGCGCTGGCCCATGGGTTGCGCACACGCCTGTACGAAGTGAGCAGTCAATTGGGCGCGCGCCTG
CCGCTGTACGTGGTACTGACCAAATTCGATCTGCTGGACGGCTTCGACCAGTTCTACAGCCAGCTTCCGG
CCGCCAAGCGTGAAAGCCTGTTGGGGTTCACCTTCAAGCTGGATGCGGTTGACGCGTTCGACGCCTGGCT
GGATGAGTATGACGAGCACTACGGGCGGCTTCTCACCCAATTGCATGAGCAGGTCATCGATCGGCTGGAT
GTACTGGGCAAGACAGCACCGTGCGTGCGCCTGTTCTCACTGCATGCACAGCTGATCGGGTTGCGCCCCA
TACTGCAGGCATTCTTGCGCGAAACCCTGGCGAGTGACCGGTTCACCACGCCACCCTTGGTGCGTGGTGT
GTACTGGTCGTCTGTGGTACAGCAAGGCGACATGCGCAATGCCTTTGTCCGTGAAGCGGCTCAGCCCTAC
ACGACGAAGCTACCCCTGCGTGAAGGTAAAGCACAGGGGAAGGCGTTGGTCTATTTCATCCAGCAAGCAT
TCAGGCGGGTTATTTACCAGGAAGCCGGGCTGGCGGGCGACAATGTTCGGGTAGCGCGCAGCAAGCGCCA
CTTGTTGTGGGTGGGCTCTGGTGTAGGCATCCTGGCGTTCAGTATCGCCATTGCCAGCTGGCAGCGTTAC
GCCGAGATCAATGGCGCCAAGGCTGCCAGTGTGCTCGCCAAAAGCCAGGAGTACGGCGGTCACGAAGTCG
ATATGCGTCTTGATCCGACCGGGCGCAACCTGCTGGCGCCACTGGACCAGATTCGCGATGCGGTGGCGGT
GTTTGGAGACTATCGTGCGGCCTGGCCGGTGGTTGCCGATTTTGGCTTGTATCAAGGGCGCAACATTGGT
CCCTTGGTTGATGAGGCGTACCTCAGCTTGTTGTCGAAACGTTTCTTGCCGGCCTTGGCCAGTGGTGTGA
TCGATGCCATGAACGCTGCACCACCTGGCAGTGAGCAACAAATGGCCGCGCTCAGGGTTTACCGGATGAT
CGAGGACCGCAATAGCCGCCGGCCAGAATGGGTCGAGGACTGGATGGCCCGTCAGTGGCAACGGGCCTTT
CCTGGCCAGGGTCAGTTGCAGCGTGACCTCATGCAGCACCTGAAGTACGCCTTGGCCTATGCCGATACCG
ATTTGCCGCAGTACCGCCAGCGGGTCAGCGAAGTGCAGCAGGCGTTGCGCAAATTGCCGTTGCCACAGCG
GGTCTACGCTGGGCTGAAACAACAATCGTACGAGCAGGTGCACGCCGGGCTGGACCTGCGCCACCAGGTA
GGGCCTGCGTTCGATGTGGTGTACCAGCCGTCTTCCGGGTCAAGGCAAGGGGGGGAGGATGTAAGGCTGG
CCGGCATGCTCACCGCCAAGGGCTTCAGGGATTACTTCGAGCCGCACAGCCAACGCTTCGCTGAAATGGC
GATGGTTGATCAATGGGCATTGGGGGAGCGCAGTCAACTCGACTATTCGGACGTCGACCGCGATGCGTTG
ACCGAGCGGCTGTATAACCTCTACAGCGCCGATTACATTGACAGCTGGCGGCGCGCCCTGAACGCGTTTA
CGGTGGCTGACTTCCGTGATCTGGACCATGGTGTCGCGATCCTGGAGCAGTTGACCGGCCCCGCAGCACC
GTTGCAACGGCTGCTGGATACGGTCAGGGATAACACCTCGCTTGCGTCTCCAGCAGTTGTTGAATCACCG
GGTGAGCTGAGTACGCTGCGGGTAGCAACCGGAAAACCCGAGCAACAGCAAGCGTTGGCTATCCAGCGGG
CGTTTGCAGGCCTGGGCGCCATGCTGCAGGCGACAGGAGAAAAGCCGAGCTACTACGATGAAACCCTCGG
CGCTGTTGCGGCCGTGCTGGACTACGCCAAGGCCGTACAGGACAGCCCGGACCGCGGCAAGGCCGCGTTG
CAAGCCGTGCATCAGCGCTTTGCGATGACAGGGCAGGACCCGATCGGCACCCTGCAACGTGTTGCCACAG
GTTTACCGGAGCCTATCAGCCACCAGGTCAGAAAGCTCGCCGACCAGACTGCCCAGGTGCTGAACGTCGA
AGCACTGCGCGAACTGGAGCGACGTTGGGATGCTGACGTGTACAGTTTTTTCCAGCAACGCCTGGCAGGC
CGCTACCCCTTTGTGGTGAAGGCACCCGATGCTTCTTTGGATGACTTCGAGGCGTTCTTCGGGCCGAAAG
GGCGCCTGCAGCAGTTTAATGATCGGTATCTCAAGGTTTTCCTGAAGGACAACCTTGAGGCTTTGCAGTC
CGCTCAGCACGGGCAATCCCTGATTCGTGCCGACGTGATCGAGCAGCTCGAGCTGGCGGAGCGCATCCGC
GAAACCTTCTTCGATCAGCGTGGCCAGCTGAGTGTGCAGTTCAGCATCGAGCCCTTGGGGCTCAGTGCGA
ACCAGCGTACCAGCCTGCTGGACCTGGATGGCCAGTTGATTGCCTACACCCATGGCCCAAGCCATATCAC
GGGTATTGTCTGGCCCAATACCCTGGGGCAGCAGGTCCGTAGCAATCTCACCTTGCTAAGGCAAAATGGC
AACAGCAGCAGCCTGGAGTACCGTGGCCCGTGGTCGATGTTCCGCTTGCTCAGCCGCGGCGCGCTCAATG
GCCGGACGGCGACCAGCGTGGACCTGAGCTTCCGGACCGGAGATGGCGTGATGCGCTATCGGCTTAACGC
TGAAAAAGCCTTCAATCCTATTACCCAGCAACCGTTCAAAGGCTTCCGCTTGCCCCGAGGCTTATTGCAA
CAGCCAGCCAATGGGGTGCAGGCGGCGCTATCGTATGAGCAGCGACTATGA
 Primer design