SecReT6
Protein ID: 397695206
SecReT6 ID685
T6SS typei4b
Gene symbolompA
Locus tagT1E_2448
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]2684203..2686698 [-]
ProductOmpA domain-containing protein
NoteTssM
UniProt IDI7AZW8
KEGG IDppx:T1E_2448
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.50E-67, Aligned region: 90..111
ImcF-related_N [PF14331], Evalue: 3.50E-67, Aligned region: 189..453
OmpA [PF00691], Evalue: 5.30E-16, Aligned region: 716..810
IcmF-related [PF06761], Evalue: 5.60E-09, Aligned region: 94..133
IcmF-related [PF06761], Evalue: 5.60E-09, Aligned region: 497..637
Protein Sequence: 831 a.a.     [Download]
>gi|397695206|ref|YP_006533087.1| OmpA domain-containing protein [Pseudomonas putida DOT-T1E]
MNKLKYYCLRYQPYLLGVAFFLAIFLVWAIGRAFGFASLHSLLAGIGVFLLLSAGYVLLLYRGVGQHHNL
EGLLRDDADQAVLSAAPADREEVSLLRERLLQGIERLHSNKPRGTSNKDALYALPWYLVIGQPAAGKSTM
ILQSGLNFPYAEREGVRVAGLGGTRNCDWFFSSEAVLLDTAGRYMNSPEEAGKWRGFLQLLRQHRQRRPL
NGLIVSVSIADILHGSVEDQERVAKRLRERIQESCALLEVRLPIYLVFTKCDLIPGFTAFYRQLDDAARG
EVMGKTFSHKGYEQADWGQRFSNAMDELTRYWGQMASQQLVQQDIQVTRQNNAAYRFPLELAALKPRLHQ
FVDSLLRANPYQNAEMLRGFYFTAALQADEAQWGCHGQHVAERFALEHAEGTGTAGSQPAPLFINSLFRK
VIIPDQHLVALYTSNHRERRRKAGWVGAAGLAALVLCSLWGWSYLNNRATLASIAGELAQAKADDQAASG
QYTAWRSLDRLRFWAAHYHEQHHAKGVPLGMRLGLYQGHEVEPLLRDRYFATLQNVMLKPTADNLTRTLY
LLTTLKVYQRNTRELQPVSGIDSVEAEALPHDNRAQSIANFGKAALDTYVMLSPGQREHADPAFLKAHLP
DYWYPAIARHTGKSMAAAGSEAGGNQDYLYASRQITFYSDQIREPDVPRILDNAFLMSSSRNYIDSLRAQ
SLRAIETITLESDTLFAFGRADFQSLKNEGQHQLSAIASKLLNTPNIGKIIISGHADQLGDSQGNLQVSK
QRAQTIRTYLVGKGVPAELVVAQGEGSRKPLVNCDMQQPRTQLIKCLEPNRRVEIEVRGLN
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c2686698-2684203 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGAACAAGCTCAAGTACTACTGCCTGCGCTACCAACCCTACCTGCTGGGCGTGGCATTCTTCCTGGCGA
TCTTCCTGGTCTGGGCCATCGGCCGAGCCTTCGGCTTCGCCTCGCTGCACAGCCTGCTGGCCGGGATCGG
CGTGTTTCTGCTGCTGTCGGCGGGCTATGTACTGCTGCTGTACCGCGGCGTGGGTCAGCACCACAACCTT
GAAGGCCTGCTGCGCGACGACGCCGACCAGGCCGTACTCAGTGCAGCCCCGGCCGACCGGGAAGAAGTCA
GCCTGTTGCGCGAGCGCCTGCTGCAGGGCATCGAGCGCCTGCACAGCAACAAGCCGCGCGGTACTTCGAA
CAAGGATGCCCTGTATGCCCTGCCCTGGTACCTGGTCATTGGCCAGCCTGCCGCCGGCAAGAGCACGATG
ATCCTGCAGTCAGGCCTGAACTTCCCCTATGCCGAGCGCGAAGGCGTGCGGGTCGCGGGCCTGGGCGGCA
CGCGCAACTGCGACTGGTTCTTCAGTTCTGAAGCGGTACTGCTGGACACTGCCGGGCGCTACATGAACAG
CCCCGAGGAAGCCGGCAAGTGGCGCGGCTTTTTGCAACTGCTGCGCCAGCACCGCCAGCGCCGTCCCCTT
AACGGCTTGATCGTCAGCGTCAGCATCGCCGATATCCTGCATGGCTCGGTCGAAGACCAGGAGCGCGTGG
CCAAGCGCCTGCGCGAACGCATTCAGGAAAGCTGCGCGCTGCTTGAAGTGCGCCTGCCAATCTACCTGGT
TTTCACCAAGTGCGACCTGATCCCTGGTTTCACCGCGTTCTATCGCCAGCTGGACGACGCCGCGCGTGGT
GAAGTGATGGGTAAAACCTTCTCTCACAAGGGGTATGAGCAAGCCGACTGGGGCCAGCGCTTCAGCAATG
CGATGGACGAGCTGACCCGTTACTGGGGGCAGATGGCGAGCCAGCAGCTGGTGCAGCAGGACATACAAGT
CACTCGGCAGAACAACGCTGCCTACCGCTTCCCGCTGGAACTGGCCGCGCTCAAGCCGCGCCTGCATCAG
TTCGTCGACAGCCTGCTGCGTGCCAACCCTTACCAGAATGCCGAAATGCTGCGCGGTTTCTATTTCACCG
CGGCGCTGCAGGCCGACGAGGCTCAGTGGGGCTGCCACGGCCAGCATGTGGCCGAACGCTTCGCGCTCGA
ACACGCAGAAGGAACGGGCACTGCCGGCAGCCAGCCGGCGCCGCTGTTCATCAACAGCCTGTTCCGCAAA
GTGATCATTCCCGACCAGCATTTGGTGGCGCTGTACACCAGCAACCACCGTGAACGCCGGCGCAAGGCCG
GGTGGGTTGGCGCCGCCGGCCTGGCGGCACTGGTGCTGTGCAGCCTGTGGGGCTGGTCGTACCTGAACAA
CCGCGCCACCCTGGCCAGCATTGCCGGCGAACTGGCCCAGGCCAAGGCCGACGACCAGGCGGCCAGCGGC
CAGTACACCGCCTGGCGAAGCCTAGACCGCCTGCGCTTCTGGGCTGCTCACTACCATGAGCAACACCACG
CAAAGGGCGTGCCCCTCGGCATGCGCCTGGGCCTGTACCAGGGCCATGAGGTCGAGCCGCTGCTGCGCGA
CCGCTACTTCGCCACGTTGCAGAATGTGATGCTAAAGCCCACGGCCGATAATCTGACCCGCACCCTGTAC
CTGCTGACCACGCTCAAGGTCTACCAGCGCAACACCCGTGAGCTGCAGCCAGTGAGCGGTATTGACAGCG
TGGAGGCCGAGGCGCTGCCCCATGACAACCGCGCCCAGTCGATCGCCAATTTCGGAAAGGCGGCGCTGGA
CACTTATGTGATGCTTTCTCCGGGCCAGCGCGAGCATGCCGACCCGGCGTTTCTCAAGGCGCACCTGCCG
GACTACTGGTACCCGGCCATCGCCCGCCATACCGGTAAGAGCATGGCCGCCGCTGGCAGCGAGGCCGGTG
GCAACCAGGACTACCTGTACGCCAGCCGCCAGATCACGTTCTACAGCGACCAGATTCGAGAGCCAGATGT
ACCGCGCATCCTCGACAACGCCTTCCTGATGTCCAGTTCGCGCAACTACATCGATAGCCTGCGGGCCCAG
TCACTGCGTGCCATCGAGACCATCACGCTGGAGTCCGACACCCTGTTCGCCTTCGGCCGCGCCGACTTCC
AGAGCCTGAAAAACGAAGGCCAGCATCAGCTGAGCGCAATTGCCAGCAAGCTGCTGAACACCCCGAATAT
CGGCAAGATCATCATCTCGGGGCACGCCGACCAACTGGGTGACAGCCAGGGCAACCTGCAGGTTTCGAAA
CAACGGGCGCAAACCATCCGCACCTATCTGGTTGGCAAGGGCGTACCTGCCGAGCTGGTGGTCGCGCAGG
GCGAAGGCAGCCGCAAGCCATTGGTCAACTGCGACATGCAACAACCGCGAACGCAGTTGATCAAGTGCCT
GGAGCCCAACCGCCGGGTGGAAATCGAAGTGCGTGGGCTTAACTGA
 Primer design