SecReT6
Protein ID: 397695208
SecReT6 ID685
T6SS typei4b
Gene symbol-
Locus tagT1E_2450
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]2687600..2691403 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDI7BVS8
KEGG IDppx:T1E_2450
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.00E-60, Aligned region: 181..435
IcmF-related [PF06761], Evalue: 8.40E-45, Aligned region: 491..555
IcmF-related [PF06761], Evalue: 8.40E-45, Aligned region: 635..878
DUF1215 [PF06744], Evalue: 2.70E-23, Aligned region: 317..343
DUF1215 [PF06744], Evalue: 2.70E-23, Aligned region: 780..821
DUF1215 [PF06744], Evalue: 2.70E-23, Aligned region: 1011..1126
AAA_16 [PF13191], Evalue: 0.0002, Aligned region: 112..258
AAA_16 [PF13191], Evalue: 0.0002, Aligned region: 459..459
AAA_16 [PF13191], Evalue: 0.0002, Aligned region: 881..939
Protein Sequence: 1267 a.a.     [Download]
>gi|397695208|ref|YP_006533089.1| ImcF domain-containing protein [Pseudomonas putida DOT-T1E]
MKTLLRLLKSFWVLLPLLWLASLLICWLAAPLVPGLRHHVPEALAIISACFLLVIVLRQYQRIRAEHNLE
NLLQIEVDRSWNATGEFRDQQVLRERLKHAIAMLRTDRSAGGGGKAALSDLPWYLVVGMSAAGKTSLLTH
SGLSASIATANDSESGTQHCDWYFSPDAVMIDTAGRYLRDDQSASEFSAFLRMLRKQRGKAAINGLVLVV
SLPELLAANSDERNALAAQLVARVEEYAECLDANPPVYLMLSKTDQLPGFSQAFDGLDLHERQQPLGMTF
GLSEIRTNGLHAVLQTRLKKLQAHIRQHVDAQMIALGAEADSTLLNFPQYFAALSGVLEQFLDHFTRGHR
GGAPLLLRGLYFTSALQNGQQLGQVYEDVIADEFALQAAYDEQAGHVGKALGNRSYFITDTFRQVIFPDR
DLILYQSRLGRQAAFSPLLLGLAAATGLLFIGWQALSFANNRQWLDSLRGQLAHIEQAADREQQLAAGKG
LEVLREQMANVEAHRLQGVPLQLGGGLYQGEAIHQVTRSAYLAQLRSQALEPIARSLQVQMRAFNTFANG
INQELEFTPAPQPKKRNGKPLAPAIAARAQAALGNTRAGAYAAKVNLATASDGAELSAATGGLSLSEEML
GRLDEQQVASIIEAYNTLKLYLLLTEPQAHPDPAFVAASLPQAWASAAAEGTPADAGVIAENAPLYVQLL
EQGQAPSLPRNEQLINETRQNLKSFMISSSLVDREYLRLQLESSRQFPALSLNDLVPQPGRALLYGTAGV
PAIYTRQGWDTFVKPELIKLVSGNLRNESDWVLDGEGGDAIVQKANFVREFMTRYKRDYTQAWYKMVSSV
GVRHFADLASATRELGLLSDVQNSPVKNLLQAVNDNTQWDLPVKQAIPAPGTSRDDGFWSKVTGLFDAND
TLPANVAPALPAVDDGSLAKRFEPVARVFAENNAEGADSTIMDRYLAALRKLKVRMNNIQRSQDVGKSSK
QLISETLEGQPSEITTVRNYVESSVDTSQDGLSRSLQGLFSLPIQYAWATLRDPAGEQIAKAWAQQIAKP
WEQVMAHRYPIAGSSRNEASVKDLQRFVDPDSGLLPAFKRNEIGNLAGGEGLGVGDGKGPALVNPGMLNS
IDKASSVGQVIASLSDRDNGFEIMLEPSANFTDIVFTLDGQEQHYRNGRSSWNRFAWPGTSTAPGARLDV
VTLSGTRVTVFDFPGRWGLLRMNESARVDDLDGIQQRFSWNTASGRVSLIVRNFGGVKLTDLGDVKALSA
LNSRGAQ
 
Nucleotide Sequence: 3804 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c2691403-2687600 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGAAAACATTACTGCGTCTGTTGAAAAGTTTCTGGGTGCTGCTGCCATTGCTGTGGCTGGCTAGCCTGT
TGATTTGCTGGCTGGCCGCGCCGCTGGTGCCGGGGCTGCGTCATCACGTGCCTGAAGCGCTGGCAATCAT
CAGTGCCTGCTTCCTGCTGGTAATCGTGCTGCGCCAATACCAGCGCATTCGTGCCGAACACAACCTGGAG
AACCTGCTGCAGATCGAGGTCGACCGCTCGTGGAATGCCACTGGCGAGTTCCGTGACCAGCAGGTGCTGC
GTGAGCGCCTGAAGCACGCCATCGCCATGCTGCGCACCGACCGCTCCGCGGGTGGCGGCGGCAAGGCGGC
CCTGTCCGACCTGCCCTGGTACCTGGTGGTCGGCATGTCGGCGGCCGGCAAGACCTCGCTGCTGACCCAT
TCCGGCCTGTCGGCCAGCATCGCTACGGCCAACGACAGCGAAAGCGGCACCCAGCACTGCGACTGGTACT
TCAGCCCCGACGCCGTGATGATCGACACCGCCGGGCGCTACCTGCGCGACGACCAGTCGGCCAGCGAGTT
CTCGGCCTTTCTGCGCATGCTGCGAAAGCAGCGCGGCAAAGCGGCGATCAATGGCCTGGTGCTTGTGGTC
AGCCTGCCCGAGCTGCTGGCGGCCAACAGCGATGAGCGCAATGCCCTGGCGGCCCAGTTGGTGGCACGGG
TGGAAGAATACGCCGAATGCCTCGATGCCAACCCGCCGGTTTACCTGATGCTGAGCAAGACCGACCAGTT
GCCGGGCTTCAGCCAGGCTTTCGACGGCCTCGACCTGCACGAACGCCAGCAGCCGCTGGGCATGACCTTT
GGCCTTTCGGAAATCCGCACCAACGGCCTGCACGCCGTGCTGCAGACGCGCCTGAAGAAGCTGCAGGCTC
ATATTCGCCAGCACGTCGACGCGCAGATGATCGCCCTCGGTGCCGAAGCCGACAGCACCCTGCTGAATTT
CCCGCAGTACTTCGCCGCCCTCAGCGGTGTGCTCGAGCAATTCCTCGACCACTTCACCCGCGGCCATCGC
GGCGGTGCCCCGCTGCTGCTACGTGGCCTGTACTTCACCAGTGCACTGCAGAACGGGCAGCAACTGGGGC
AGGTCTATGAAGACGTCATCGCCGACGAATTCGCCCTGCAGGCCGCCTACGATGAACAGGCCGGGCACGT
CGGCAAGGCCCTGGGCAACCGCAGCTACTTCATCACCGACACCTTCCGCCAGGTGATCTTCCCCGACCGC
GACCTGATCCTTTACCAGTCGCGCCTGGGCCGCCAGGCTGCGTTCAGCCCGCTGCTACTGGGCCTGGCCG
CCGCCACCGGGTTGCTGTTCATCGGTTGGCAAGCGCTGTCGTTCGCCAATAACCGCCAGTGGCTGGACAG
CCTGCGCGGGCAGCTGGCGCACATCGAACAGGCAGCAGACCGCGAGCAGCAGCTGGCCGCAGGCAAGGGC
CTGGAAGTGCTGCGTGAACAGATGGCCAACGTCGAGGCCCATCGCCTGCAGGGAGTGCCCTTGCAGTTGG
GTGGCGGCCTGTACCAGGGCGAGGCGATTCACCAGGTGACCCGCAGCGCCTACCTGGCGCAGCTGCGCAG
CCAGGCGCTGGAACCGATCGCACGCAGCCTGCAGGTGCAGATGCGGGCGTTCAACACCTTCGCCAACGGT
ATCAATCAGGAGCTGGAATTCACCCCGGCCCCGCAGCCGAAGAAGCGCAATGGCAAGCCGCTTGCCCCTG
CCATTGCGGCCAGGGCCCAGGCCGCGCTGGGCAACACCCGCGCTGGCGCCTATGCCGCCAAGGTCAACCT
GGCCACTGCCAGCGATGGCGCCGAGCTGTCCGCCGCCACCGGTGGGCTGTCACTGTCCGAAGAAATGCTC
GGGCGCCTGGACGAGCAGCAGGTGGCCTCGATCATCGAGGCCTACAACACCCTCAAGCTGTACCTGTTGC
TGACCGAGCCACAGGCCCATCCAGACCCGGCCTTCGTCGCTGCCAGCCTGCCCCAGGCGTGGGCCAGCGC
CGCCGCCGAAGGCACCCCGGCCGACGCTGGCGTGATCGCGGAAAATGCCCCGCTGTACGTGCAGTTGCTG
GAACAGGGCCAGGCGCCGTCGTTGCCGCGCAACGAACAGCTGATCAACGAAACCCGGCAGAACCTCAAGT
CGTTCATGATCTCCAGCTCGCTGGTCGATCGCGAGTACCTGCGCCTGCAGCTCGAGTCGAGCCGGCAGTT
CCCGGCGCTGAGCCTCAACGACCTGGTCCCGCAACCAGGCCGCGCGCTGCTGTACGGAACCGCGGGTGTG
CCGGCGATCTACACCCGCCAGGGCTGGGACACCTTCGTCAAGCCCGAGCTGATCAAGCTGGTGTCGGGCA
ACCTGCGCAACGAGTCGGACTGGGTGCTGGACGGCGAAGGCGGCGATGCCATCGTGCAGAAGGCCAACTT
CGTACGCGAGTTCATGACCCGCTACAAGCGCGACTACACCCAGGCCTGGTACAAGATGGTCAGCAGCGTT
GGCGTGCGCCACTTCGCCGACCTGGCCTCGGCGACCCGGGAACTGGGGCTGTTGAGCGACGTGCAGAACT
CGCCAGTGAAGAACCTGCTGCAGGCCGTCAACGACAATACCCAGTGGGACCTGCCGGTCAAGCAAGCCAT
CCCGGCCCCCGGCACCAGCCGCGATGACGGTTTCTGGAGCAAGGTCACCGGTCTGTTCGACGCCAACGAC
ACCCTGCCTGCCAACGTCGCGCCGGCCCTGCCGGCGGTGGACGACGGCAGCCTGGCCAAGCGCTTCGAGC
CGGTGGCGCGGGTGTTCGCTGAAAACAACGCCGAAGGTGCCGACAGCACCATCATGGACCGCTACCTGGC
CGCCTTGCGCAAACTCAAGGTGCGCATGAACAACATCCAGCGCTCGCAGGATGTGGGCAAGAGCAGCAAA
CAGTTGATCAGCGAGACCCTGGAAGGCCAGCCGAGCGAGATCACCACCGTGCGCAACTACGTGGAAAGCA
GCGTCGACACCAGCCAGGATGGCCTGTCGCGCTCGCTGCAGGGGCTGTTCAGCCTGCCCATCCAGTATGC
CTGGGCGACCCTGCGCGACCCGGCCGGCGAGCAGATCGCCAAGGCCTGGGCGCAGCAGATCGCCAAGCCC
TGGGAGCAGGTCATGGCACACCGTTACCCGATTGCCGGCAGCAGCCGCAACGAGGCTTCGGTGAAAGACC
TGCAACGCTTCGTAGATCCCGACAGCGGCCTGCTGCCGGCCTTCAAGCGCAACGAAATCGGCAACCTGGC
CGGTGGTGAAGGTCTGGGTGTGGGCGATGGCAAGGGGCCGGCGCTGGTCAACCCTGGCATGCTCAACAGC
ATCGACAAGGCCAGCTCCGTGGGCCAGGTGATCGCCAGCCTGTCGGACCGTGACAACGGCTTCGAAATCA
TGCTGGAACCTTCAGCCAACTTCACCGACATCGTCTTCACCCTCGATGGCCAGGAGCAGCACTACCGCAA
CGGCCGCAGCAGCTGGAACCGCTTCGCCTGGCCGGGCACCAGCACCGCGCCGGGCGCGCGCCTGGACGTC
GTCACCCTGAGCGGCACACGGGTCACCGTGTTCGATTTCCCAGGGCGGTGGGGCCTGCTGCGCATGAACG
AGAGCGCTCGGGTCGACGACCTGGACGGCATTCAGCAACGCTTTAGCTGGAACACCGCCAGTGGCCGCGT
AAGCCTTATCGTGCGCAACTTCGGCGGGGTCAAGCTCACCGATCTGGGTGACGTCAAGGCCCTGAGCGCC
CTCAACAGCAGGGGCGCGCAATGA
 Primer design