SecReT6
Protein ID: 398352716
SecReT6 ID669
T6SS typei3
Gene symbol-
Locus tagUSDA257_c28520
StrainSinorhizobium fredii USDA 257
Repliconchromosome [GenBank: NC_018000] [Browse all T6SS(s) in this replicon]
Location [Strand]2989499..2993029 [-]
Producthypothetical protein
NoteTssM
UniProt IDI3X6B7
KEGG IDsfd:USDA257_c28520
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.40E-87, Aligned region: 189..448
IcmF-related [PF06761], Evalue: 9.50E-70, Aligned region: 254..330
IcmF-related [PF06761], Evalue: 9.50E-70, Aligned region: 503..802
DUF1215 [PF06744], Evalue: 2.20E-31, Aligned region: 917..1034
Protein Sequence: 1176 a.a.     [Download]
>gi|398352716|ref|YP_006398180.1| hypothetical protein USDA257_c28520 [Sinorhizobium fredii USDA 257]
MKIFRFVWAVLTSRWLWTFIGLMLLSLLIWVFGPIISVGESTPFASEMVRLFVIGVLLLLFVIWWIAAQR
RAIRANRIFVSEIAPQPEAPPSPAEEGVASVGAKFREVMSELKRHKVGGRKFLRDMPWYVIIGPPGTGKT
TALRQSGLSFPVDLTDDLHGVGGTRNCDWFFSEEAVLIDTAGRYVQQESQPEVDAAEWLAFLDLLKKHRG
RRALNGVIVALSIETLLEGDAVIRAHGRQIRKRLTELQEHLKIRLPVYLMLTKADLIKGFETFFEGLSTA
DREQVWGATFPPGARIDGSEVSQELTALTAVLEKRLIPRLENEENLVARAEIFRFPAQVETVSEPVRVLV
ETIFGESRYAESAWLRGIYLTSATQEGTAIDRLTAALSSSFGLPAQPASPMPRAEKRSFFLRDLLSKVIF
KEAGLGTFDPAAEERRIWIWRGAVVAAAGLVLMAGLVFTISYRKNCATLAAQAEQLEALQLPLTPVAARQ
APLEPLDLDMALEAVTEVSNARSEPPAGIAALIGPSAATEIRQAQADAYDRALRNILEPRMVALLEATMW
RQIRDPEFQLGALKTYRMMTGLSPMDFEFAEQWWTERLPEFAPVPPFRTEMAADHQLAAIANMAADQSLI
SADEALVGEALRSICSIPLPVRAYNALLSDPEVRALKEWIPADHVGPNGPKVLARRSQKTFRVGISGAFT
YDGFHNVILARLEDVAAQAALDRSVFAGGCSESASPSVASLAQDILKLYYDDYISQWDSFLRDVRLAPLG
DLQTASENLKDLSSADSSMKRLLDAIVHETELTRSESDGGGKAAPAGASKLLSKLGKIGKLAKKGVKLMP
TPGSKSEVDLSGALVAEHFKPIKGAIAEVDGQPPALNDAVTALTALSNMLQTVQASPDAQDAIKRQGGLA
ELTGAVARQAATLPDPLDDWLAGIAGDTSGLTTGAVTSELNAIWRADVLPFCQAALTNRYPFVPESAIDV
NVVDFARIFSPGGLIDSFINNHLVSYIDVTRHPWKWRSDIRLDSSALAALEQSRLIRDSLFPGGAGPILT
FTLEAKDLSPTVGRVTLNVDGQSLSYYNNPTRPQPMTWPGKDGTGVITLAFQPIDGSPEVMVSETGSWAL
LRMLRAGRLTRTELPELYRLRLAAQGYYADFELRAASVANPYDLKMFARFTCPTRL
 
Nucleotide Sequence: 3531 bp     [Download]
>gi|398349897|ref|NC_018000.1|:c2993029-2989499 Sinorhizobium fredii USDA 257 chromosome, complete genome
ATGAAGATCTTCAGGTTTGTCTGGGCTGTCCTCACCTCGCGCTGGCTCTGGACCTTCATTGGCCTGATGC
TCTTATCCCTGCTCATCTGGGTATTCGGTCCGATCATCAGTGTCGGAGAGAGCACGCCATTCGCTTCGGA
GATGGTGCGGCTGTTTGTGATCGGCGTCCTCCTCCTTCTGTTTGTCATCTGGTGGATTGCGGCGCAGCGC
CGGGCGATCCGCGCCAATCGCATTTTCGTATCCGAAATCGCCCCTCAACCGGAGGCGCCACCATCCCCGG
CAGAAGAGGGCGTTGCGTCGGTGGGCGCGAAATTTCGCGAGGTGATGAGCGAACTGAAACGTCATAAAGT
CGGAGGTCGAAAGTTCCTTCGGGATATGCCGTGGTACGTGATCATAGGCCCGCCGGGAACCGGCAAGACC
ACGGCACTGCGCCAGTCAGGACTGAGCTTCCCCGTTGATCTTACTGACGATCTGCATGGGGTCGGTGGAA
CCCGCAACTGCGACTGGTTCTTCTCGGAAGAGGCGGTACTGATCGATACCGCCGGGCGCTACGTTCAACA
GGAAAGCCAACCTGAGGTCGATGCAGCGGAATGGCTGGCATTCCTCGATCTTCTGAAGAAACACCGGGGC
CGTCGCGCTTTGAACGGTGTTATCGTGGCGCTCTCTATCGAGACGCTCCTGGAGGGCGACGCGGTCATTC
GCGCACATGGTCGGCAGATCCGCAAACGGCTGACCGAACTTCAGGAACACCTCAAGATCCGCTTGCCGGT
CTACCTGATGCTGACGAAGGCGGATCTCATCAAGGGGTTCGAGACGTTCTTTGAAGGGCTCTCGACAGCC
GATCGCGAGCAGGTGTGGGGAGCGACGTTTCCCCCCGGTGCACGCATTGACGGCAGCGAGGTCTCACAGG
AACTCACGGCGTTGACCGCCGTGCTGGAAAAACGCCTCATTCCCCGCCTCGAAAACGAAGAGAACCTTGT
CGCCCGTGCAGAGATATTCCGTTTCCCCGCTCAGGTTGAGACCGTTTCGGAACCGGTTCGCGTCTTGGTC
GAGACCATCTTTGGCGAAAGTCGCTATGCCGAAAGCGCCTGGTTGCGCGGTATCTATCTTACCTCCGCAA
CCCAAGAAGGCACGGCGATCGATCGACTGACGGCCGCCCTGTCGTCGTCTTTCGGCCTGCCGGCACAGCC
AGCCTCCCCCATGCCGCGGGCCGAGAAGCGCAGCTTTTTCCTCAGGGACTTGCTCTCGAAGGTGATCTTC
AAGGAAGCGGGCCTCGGGACTTTCGATCCCGCCGCAGAGGAACGGCGTATCTGGATATGGCGCGGCGCCG
TTGTGGCCGCAGCGGGATTGGTCCTAATGGCCGGTCTGGTCTTCACCATCTCCTATCGCAAGAATTGCGC
AACTCTTGCTGCACAAGCAGAACAGCTCGAGGCCTTGCAGCTTCCGCTCACTCCGGTTGCCGCACGCCAG
GCGCCACTGGAACCCCTCGATCTGGATATGGCGCTCGAGGCCGTCACCGAGGTTTCGAATGCCCGTAGCG
AACCGCCGGCTGGTATAGCGGCCTTGATCGGCCCTTCCGCCGCCACCGAGATCAGGCAGGCTCAGGCTGA
TGCCTATGACCGCGCACTACGCAACATATTGGAACCGCGTATGGTCGCGCTGCTTGAGGCAACGATGTGG
CGCCAGATCCGCGACCCGGAATTCCAGCTCGGCGCGCTGAAGACGTATCGCATGATGACCGGGCTGTCGC
CGATGGACTTCGAATTCGCCGAGCAATGGTGGACGGAGCGGCTGCCTGAATTCGCGCCCGTGCCGCCATT
CCGCACCGAGATGGCCGCCGATCATCAACTCGCCGCGATCGCCAATATGGCTGCGGATCAAAGTCTGATC
TCTGCCGATGAAGCGCTGGTAGGCGAAGCATTGCGCAGCATCTGCTCGATTCCACTGCCTGTGCGCGCCT
ATAACGCACTGCTCTCCGATCCGGAGGTCAGGGCGCTGAAGGAATGGATCCCCGCGGATCATGTCGGCCC
GAACGGCCCGAAGGTTCTCGCTCGCCGCTCGCAGAAGACCTTTAGAGTAGGGATCAGCGGGGCCTTCACC
TATGACGGCTTCCATAACGTGATCCTCGCCAGGCTGGAGGACGTGGCCGCGCAGGCTGCGCTCGATCGTT
CCGTCTTTGCCGGCGGCTGCTCGGAAAGCGCCAGCCCGTCAGTCGCGTCGCTTGCTCAGGACATCCTCAA
GCTCTACTACGACGACTACATTTCGCAGTGGGATAGCTTCCTGCGCGATGTCAGGCTCGCCCCGCTTGGG
GACCTGCAGACTGCCAGCGAGAATCTCAAGGATCTCTCCAGTGCGGATTCCTCAATGAAGCGGCTGCTGG
ACGCAATCGTGCACGAGACGGAACTTACCCGTTCCGAATCCGATGGCGGCGGCAAAGCGGCCCCGGCCGG
AGCATCCAAGCTGCTGTCGAAGCTCGGCAAGATCGGCAAGCTCGCGAAAAAAGGCGTTAAGCTGATGCCC
ACCCCCGGCTCGAAGTCCGAAGTGGATCTCTCGGGCGCATTGGTCGCAGAGCATTTCAAGCCCATCAAGG
GCGCAATCGCCGAGGTCGACGGCCAACCTCCGGCACTCAATGACGCAGTCACGGCGCTGACCGCGCTCTC
GAACATGCTGCAGACCGTACAGGCAAGTCCCGATGCCCAGGACGCAATCAAGCGACAAGGCGGCTTGGCC
GAACTCACGGGGGCCGTGGCAAGGCAGGCCGCGACCCTGCCCGACCCGCTCGACGATTGGCTGGCAGGCA
TCGCCGGGGACACCAGCGGTCTTACAACGGGAGCCGTCACCTCAGAACTGAACGCCATCTGGCGCGCGGA
CGTGTTGCCCTTCTGTCAGGCTGCGCTCACGAATCGATACCCGTTCGTCCCTGAGAGCGCAATCGACGTC
AACGTCGTTGACTTTGCCCGTATCTTCAGTCCCGGAGGACTGATCGACAGCTTCATAAACAATCACCTGG
TCAGCTATATCGACGTAACCCGGCACCCCTGGAAGTGGCGCTCGGATATCCGGCTTGATTCATCCGCTCT
GGCAGCCCTGGAGCAGAGCCGGCTGATCCGCGACAGTCTTTTCCCCGGCGGCGCCGGACCGATCTTGACC
TTTACACTCGAGGCCAAGGACCTTTCGCCGACCGTCGGCCGCGTCACGCTGAACGTCGATGGACAAAGCC
TCTCCTACTACAACAACCCAACCCGACCGCAGCCGATGACCTGGCCAGGCAAGGACGGAACCGGCGTGAT
TACCCTCGCCTTCCAGCCGATCGACGGCTCGCCGGAGGTAATGGTCAGCGAGACAGGAAGCTGGGCATTG
CTGCGGATGCTGCGTGCCGGGCGGTTGACGAGGACCGAGCTTCCGGAACTCTACCGGCTGCGGCTTGCCG
CCCAAGGCTACTACGCAGATTTTGAGCTACGGGCGGCGAGCGTAGCCAATCCCTACGACCTGAAAATGTT
CGCGAGGTTTACGTGTCCGACGCGGCTTTGA
 Primer design