SecReT6
Protein ID: 398352733
SecReT6 ID669
T6SS typei3
Gene symbol-
Locus tagUSDA257_c28690
StrainSinorhizobium fredii USDA 257
Repliconchromosome [GenBank: NC_018000] [Browse all T6SS(s) in this replicon]
Location [Strand]3012413..3014878 [+]
Producthypothetical protein
NoteTssM
UniProt IDI3X6D4
KEGG IDsfd:USDA257_c28690
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.80E-32, Aligned region: 230..481
DUF1215 [PF06744], Evalue: 2.90E-19, Aligned region: 452..481
DUF1215 [PF06744], Evalue: 2.90E-19, Aligned region: 601..684
DUF2077 [PF09850], Evalue: 1.70E-05, Aligned region: 6..84
DUF2077 [PF09850], Evalue: 1.70E-05, Aligned region: 116..165
Protein Sequence: 821 a.a.     [Download]
>gi|398352733|ref|YP_006398197.1| hypothetical protein USDA257_c28690 [Sinorhizobium fredii USDA 257]
MRADVLPALAQPLLALAKRAESENRPDPNELAATARTLVAAFETEARRMNIPSDWLLDARNALIALLDAR
AHNNPALPTRRWERALAAALPISLSIDPKRLADRAAEAARSGPARRDLARFLGHCNEAVQAAHSVGEKHK
TRADRGLVFVAVAFFFAVLVAWVAWAEWRFREQLLAQLPEVRRVIEAGNTQTPAARAAQLDSFAAAVRLV
EQDAARSPLGLIHYVESVDPGAAARRRYSDVADALIAEPLAEALGVALATEGEPSALYDSLRAWSILKGT
SGWQPHFLAGWVADRAGTFPELAHLAQHVAAMSKAPVGIPSPDPETISQARQFASEGLASERALLELTRA
EETAALPSWSLGEAVPGLDAILINRSGLPIERGVPGLFTEAGWNHARSGGVEQAIRRASSEAATLLAADG
TATNDAVMDLLQKRTLEAWSQYLGDLRVRPFSDQPTAVVISGALSASNSPLSALIREVWRQSGGTDRNRS
HANQLRVAAALGPAIQFVEQGRMSDISHLFVSLNVALSVLDADAELGKKSLMDARERANSIVALQQAPLL
VVQIVEDVIAQTAVPKVSEAAADPVPPEAPADPVAPARPQTPWGSKIATACQAAVSGRYPFFDGPDADIA
EVARIFAPDGTVGSYFRAQLAQLMDTSTTPWRWKPEARLSGYTPESAAFFQKALAVGDAFFQQGASPDVP
IALEALAQRGAATISVGGAHVPVVTSGETVTLNWPGPSPARGFEISFGGGAVVEKKSTPGPWGLLRFLDG
ARLRPRDSGRRFLIDVRAKGARVYLQMSFARSANPVAARALLRGLICPSSL
 
Nucleotide Sequence: 2466 bp     [Download]
>gi|398349897|ref|NC_018000.1|:3012413-3014878 Sinorhizobium fredii USDA 257 chromosome, complete genome
ATGCGAGCAGACGTTCTTCCTGCACTGGCGCAGCCACTGCTTGCCCTGGCAAAGCGGGCCGAAAGTGAGA
ATAGACCGGATCCAAATGAGTTGGCTGCGACTGCCCGCACGCTCGTGGCTGCATTCGAGACCGAAGCGCG
CCGCATGAACATTCCGTCGGACTGGCTCCTCGATGCACGCAATGCGCTTATCGCATTGCTCGATGCGCGT
GCGCACAATAACCCGGCGCTGCCAACACGGCGATGGGAGCGGGCGCTGGCGGCCGCGCTGCCAATTAGCT
TGAGCATTGATCCGAAACGCCTCGCCGACCGGGCGGCCGAGGCAGCCAGAAGCGGGCCGGCGCGGCGTGA
TCTTGCCCGTTTTCTTGGGCACTGCAACGAGGCAGTTCAAGCTGCCCATTCGGTCGGTGAGAAGCATAAA
ACCCGAGCAGATCGCGGCCTGGTTTTCGTCGCGGTCGCATTCTTCTTCGCGGTCCTTGTGGCCTGGGTAG
CGTGGGCCGAATGGCGTTTTCGCGAGCAGCTTCTGGCGCAATTGCCCGAAGTGAGACGAGTTATCGAAGC
TGGCAACACTCAAACTCCGGCCGCGCGCGCGGCTCAGCTCGATTCCTTCGCCGCCGCAGTGCGCCTCGTA
GAGCAGGATGCTGCTCGCTCGCCGCTCGGCCTCATTCATTATGTTGAGAGCGTCGACCCGGGTGCGGCTG
CGCGTCGCCGCTATAGCGACGTGGCGGATGCGCTTATTGCAGAGCCTCTCGCCGAGGCCCTTGGTGTTGC
CCTCGCAACGGAGGGGGAGCCGAGCGCGCTCTACGATTCACTGCGTGCCTGGTCGATACTGAAGGGCACA
TCTGGCTGGCAGCCCCATTTTCTGGCGGGCTGGGTCGCCGACCGGGCTGGGACCTTTCCCGAACTGGCGC
ATCTTGCCCAGCATGTTGCCGCTATGTCCAAGGCCCCGGTGGGTATTCCATCTCCGGATCCCGAAACGAT
TTCCCAAGCACGGCAGTTCGCTTCTGAGGGATTGGCGAGTGAGCGCGCCTTGCTCGAATTGACCCGGGCT
GAGGAAACGGCAGCACTCCCTTCGTGGTCTCTTGGCGAGGCGGTCCCTGGCCTCGACGCGATTTTGATCA
ACAGGTCGGGTCTGCCGATCGAACGTGGCGTACCGGGCTTATTTACGGAGGCTGGATGGAACCATGCTCG
GTCCGGCGGCGTGGAGCAGGCGATCCGGCGGGCAAGCTCGGAGGCCGCTACACTCCTGGCAGCTGACGGC
ACGGCAACAAACGACGCGGTAATGGATCTTCTTCAAAAGCGCACACTCGAGGCATGGTCGCAATACCTCG
GTGATCTTCGCGTCCGGCCGTTTTCCGATCAACCTACCGCCGTGGTAATCAGCGGTGCGCTGAGCGCGAG
CAACTCGCCGCTTTCGGCGCTAATTCGAGAGGTCTGGCGCCAGTCCGGCGGCACCGATCGCAACCGAAGC
CATGCCAACCAGCTTCGCGTCGCAGCGGCGTTGGGTCCGGCTATACAGTTCGTGGAGCAAGGGCGGATGT
CGGACATCTCCCATCTCTTTGTGTCGTTGAACGTAGCCCTCTCCGTTCTCGATGCAGATGCGGAGCTCGG
AAAGAAATCCCTCATGGACGCTCGGGAGCGCGCCAACTCAATTGTAGCATTGCAGCAAGCCCCCCTTCTT
GTCGTGCAGATCGTCGAGGATGTGATTGCACAGACGGCTGTACCGAAAGTGTCCGAAGCTGCTGCGGATC
CTGTCCCACCTGAAGCTCCTGCGGATCCTGTCGCACCAGCCAGACCTCAGACACCATGGGGTTCTAAGAT
CGCGACCGCCTGTCAAGCCGCCGTGAGCGGTCGTTACCCCTTCTTTGATGGGCCCGATGCTGATATCGCC
GAAGTGGCTCGAATCTTCGCCCCTGACGGCACAGTCGGGAGCTATTTTCGTGCGCAGCTGGCACAATTGA
TGGATACGTCGACAACGCCGTGGCGCTGGAAGCCGGAAGCGCGACTTTCTGGCTACACACCCGAAAGCGC
AGCCTTTTTCCAAAAAGCCCTTGCCGTGGGCGACGCCTTCTTTCAACAGGGAGCGTCGCCCGACGTTCCG
ATCGCGCTTGAGGCGCTCGCTCAAAGAGGAGCAGCAACGATCTCGGTCGGCGGTGCTCATGTCCCGGTCG
TCACCTCCGGAGAAACGGTCACCTTGAACTGGCCAGGACCCTCACCGGCGCGCGGTTTTGAAATATCCTT
CGGTGGCGGCGCTGTTGTAGAGAAGAAGAGCACGCCCGGACCATGGGGACTTTTGCGGTTCCTGGACGGG
GCACGCTTGCGGCCACGTGACAGTGGTAGGCGCTTCCTGATTGATGTGCGTGCGAAGGGCGCGCGCGTCT
ATCTTCAGATGTCATTCGCAAGATCCGCAAATCCGGTCGCGGCGCGTGCACTGCTACGAGGCCTGATTTG
CCCGTCCTCGCTTTGA
 Primer design