SecReT6
Protein ID: 39998256
SecReT6 ID12
T6SS typei1
Gene symbol-
Locus tagGSU3166
StrainGeobacter sulfurreducens PCA
Repliconchromosome [GenBank: NC_002939] [Browse all T6SS(s) in this replicon]
Location [Strand]3470702..3474154 [+]
Producthypothetical protein
NoteTssM
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.70E-63, Aligned region: 180..432
AAA_16 [PF13191], Evalue: 0.00058, Aligned region: 117..242
AAA_16 [PF13191], Evalue: 0.00058, Aligned region: 782..836
DUF1215 [PF06744], Evalue: 0.0015, Aligned region: 894..930
DUF1215 [PF06744], Evalue: 0.0015, Aligned region: 944..992
Protein Sequence: 1150 a.a.     [Download]
>gi|39998256|ref|NP_954207.1| unnamed protein product [Geobacter sulfurreducens PCA]
MMKSLKWLLLASVVVLTVFLVAGIVLALDWPWWVTFCLLLLLAGIAAGAILLRSLLLRRRERHFVREVIE
QEKDTLSTLSDGSRTHLDQLAQQWKEGVGALRGSHLKRRGNPLYVLPWYLVIGESGSGKSTSLASARLPS
PYTDSRRSADDAGTRNCDWWFFEESVVLDTAGRYAVPVNGERDRDEWQKLLALLVRHRRREPLNGLVLTV
AADRLLAGGREENAEEGRTMRRRVDELMRALGVRVPVYVLVTKCDLIEGMNCFAELLPEKALRQPMGMIN
RDLTANVGSFTARTMETVTERLRSLRLQILHRPEARDATPALAFFPEEFAGLREGLTAFMEGTFRENPYQ
ETPLLRGVFFASGRQAGSPRSRFSGTLGTVAGPQPLPDTSRGIFLHDFFARVLPADRALLTPTQRSVQWR
TVTGNLGLLSWLLVGLALCGLLSFSFVKNMATIREVSRQFERTPPINADPVNNLLVLESLRQGILRVEEQ
NRAWWVPRFGLNESRRVEAVLKDKFCNQFRDGFLAPYDRHLAEELNGLSAATPDELFARYAIHLTRRINI
LTASRAGRGLDELRALPQPASLSFMAAETPSVADAHKRFGELYLHYLAWRSDSPDLAREAAQLQGWLRRS
LALKTDSLSWLAPWVDRHGGLSPVTLAEFWGGSVPAPDEPTITPSFTGKGKDRIDGLMRELETAVGDSRL
LAKARAGFVPWYRALCLQAWQGFAASFPRGAERLRGSGEWQQAATRMATEHGPYFAFITRMTQELHTLAG
TEGLPPFAAQLFAFQIARTGGAVSHDAAANVTAESRRLMASIRRRLGNEAAASTIDPTFMASRSWQEYQA
ALAAIAPAASSRQQAFQLASQTFTDDPATGKTPFHAAWNAAARLKRDIAGAGADDAFWRLVTGPLDFLWG
YVRREAGCQLQTLWEEQVLAPTLGMPPQQAGPMLLGADGLAWRFVKGPAAPFVRGTAAGYAPRQALGGAL
PLEGSLFAFLGKGAQLNAMASGRQSNYTVAIKGLPTDANPEARIKPHGTRLELQCAGQAQALANHNFPAG
KTFYWSPDSCGDVIFQIEAGDQVLTKRYAGPQAFPDFLREFASGHRTFAAGEFPGEKDALARMGITSIRV
SYQFTGSQQVIRQGGAMAGATAPRMIARCW
 
Nucleotide Sequence: 3453 bp     [Download]
>gi|39995111|ref|NC_002939.4|:3470702-3474154 Geobacter sulfurreducens PCA chromosome, complete genome
ATGATGAAATCGCTGAAATGGCTGCTGCTGGCGAGTGTCGTCGTGCTCACGGTATTCCTGGTGGCCGGGA
TCGTCCTGGCGCTCGACTGGCCCTGGTGGGTGACCTTCTGCCTGTTGCTGCTCCTTGCCGGAATCGCAGC
GGGGGCCATACTGCTGCGGTCCCTACTGCTGCGGCGCCGGGAGCGACACTTCGTCAGGGAGGTTATCGAG
CAGGAAAAAGACACCCTCTCCACCCTGTCAGACGGAAGCCGTACGCATCTGGACCAGCTCGCTCAACAGT
GGAAAGAAGGGGTGGGAGCCCTCAGAGGCTCGCACCTCAAGCGACGGGGCAACCCCCTCTACGTGCTCCC
CTGGTACCTGGTCATCGGCGAGAGCGGTTCCGGCAAGAGCACGAGCCTTGCCAGCGCCCGTCTCCCCTCT
CCCTACACCGATTCCCGACGGTCCGCCGATGATGCCGGTACGCGCAACTGCGACTGGTGGTTCTTCGAAG
AGTCCGTCGTGCTCGACACGGCGGGCCGTTACGCCGTGCCGGTCAACGGGGAGCGGGACCGGGACGAATG
GCAGAAGCTCCTGGCGCTGCTGGTCAGGCACCGGAGACGCGAACCCCTGAACGGTCTCGTCCTGACCGTG
GCGGCAGACCGACTCCTTGCCGGCGGACGGGAGGAAAACGCCGAGGAGGGGCGTACCATGCGCCGCCGGG
TGGATGAACTGATGCGCGCCCTGGGGGTGCGGGTACCGGTTTACGTGCTCGTAACCAAGTGTGACCTTAT
CGAAGGGATGAACTGCTTCGCCGAACTTCTGCCGGAAAAGGCGCTGCGCCAGCCCATGGGCATGATCAAC
CGAGATCTGACCGCCAACGTGGGCTCGTTCACGGCCAGGACCATGGAGACGGTAACCGAGCGACTCAGAA
GTCTCAGGCTCCAGATCCTCCACCGGCCCGAAGCCCGCGACGCGACGCCGGCTCTCGCCTTTTTCCCCGA
GGAATTCGCAGGGCTCCGCGAAGGGCTCACCGCGTTCATGGAAGGGACGTTCCGCGAAAACCCCTATCAG
GAAACCCCGTTGCTGCGAGGGGTGTTCTTCGCCAGCGGCCGTCAGGCCGGCAGCCCCCGTTCCCGGTTCA
GCGGGACACTGGGCACCGTTGCCGGGCCCCAACCGCTCCCCGACACCAGCCGTGGCATCTTCCTCCACGA
CTTCTTTGCCCGGGTCCTTCCCGCCGACCGGGCACTCCTGACCCCGACACAACGGTCTGTCCAGTGGCGC
ACCGTCACCGGCAACCTCGGGCTCCTCTCCTGGCTGCTGGTGGGGCTGGCCCTGTGTGGCCTCTTGTCGT
TTTCCTTCGTGAAGAACATGGCCACCATTCGCGAGGTATCGCGCCAATTCGAACGGACGCCGCCCATCAA
TGCTGATCCGGTGAATAATCTCCTGGTCCTGGAGAGCCTTCGCCAGGGGATTCTGCGCGTGGAAGAGCAG
AATCGCGCCTGGTGGGTGCCCCGGTTCGGCCTTAATGAAAGCCGGCGGGTTGAAGCTGTTCTCAAGGACA
AGTTCTGCAACCAGTTCCGGGATGGCTTTCTCGCCCCCTATGACCGTCACCTGGCCGAAGAGCTGAACGG
TCTCTCCGCGGCCACGCCGGACGAACTCTTTGCCCGGTACGCCATCCACCTGACGCGACGGATCAACATC
CTTACCGCCAGCCGGGCAGGCAGGGGGCTCGATGAACTGCGCGCCCTCCCTCAGCCGGCGTCCCTGTCGT
TCATGGCCGCTGAGACGCCGTCGGTCGCCGACGCGCACAAGCGGTTCGGAGAGCTCTATCTCCACTATCT
TGCATGGCGATCCGACTCTCCCGACTTGGCCCGCGAGGCGGCCCAGCTCCAGGGCTGGCTCAGGCGGTCC
CTCGCGCTCAAAACCGACAGCCTTTCCTGGCTCGCCCCCTGGGTTGACCGTCATGGGGGGCTATCACCCG
TAACCCTGGCGGAGTTCTGGGGAGGAAGCGTGCCGGCCCCGGATGAGCCGACGATCACCCCGTCCTTCAC
CGGCAAGGGTAAAGACCGGATTGACGGGCTCATGCGCGAACTGGAGACCGCGGTGGGCGACTCACGACTT
CTGGCGAAGGCACGGGCAGGGTTCGTCCCCTGGTACCGGGCCCTGTGCCTGCAGGCGTGGCAGGGATTCG
CAGCCTCATTCCCCCGCGGCGCCGAGAGGCTTCGGGGCAGCGGCGAGTGGCAGCAGGCCGCTACCCGGAT
GGCGACCGAGCACGGTCCGTACTTCGCGTTCATCACCCGGATGACCCAGGAGTTGCACACCCTGGCGGGC
ACGGAGGGACTCCCTCCCTTTGCAGCACAGCTCTTCGCATTCCAGATTGCGCGAACCGGGGGAGCCGTCT
CGCACGATGCAGCAGCCAACGTCACCGCCGAAAGCCGTCGCCTCATGGCCTCCATCCGCAGGAGGCTGGG
AAACGAGGCTGCGGCCAGCACCATCGATCCGACCTTCATGGCATCGCGCAGCTGGCAGGAATACCAGGCA
GCCCTGGCGGCCATCGCTCCAGCCGCATCATCGCGGCAGCAGGCCTTCCAACTGGCATCCCAGACCTTCA
CCGATGATCCCGCCACGGGGAAAACCCCATTCCATGCAGCCTGGAATGCGGCCGCACGGCTGAAGCGGGA
TATCGCCGGCGCCGGTGCCGACGACGCCTTCTGGCGCCTCGTCACCGGTCCCCTCGATTTTCTCTGGGGA
TATGTCAGGCGCGAAGCCGGTTGCCAGCTCCAGACCCTCTGGGAGGAGCAGGTCCTCGCCCCCACCCTGG
GCATGCCCCCCCAACAGGCGGGGCCAATGCTGCTGGGCGCCGATGGCCTTGCCTGGCGCTTCGTGAAGGG
CCCGGCCGCCCCCTTTGTCCGGGGCACGGCAGCGGGGTACGCCCCCCGGCAGGCACTGGGCGGAGCGCTG
CCGCTGGAGGGATCCCTCTTCGCCTTTTTGGGCAAAGGGGCACAGCTCAATGCCATGGCATCCGGCCGGC
AGTCGAACTATACCGTAGCAATCAAGGGACTTCCCACCGATGCGAACCCCGAGGCCCGGATCAAGCCGCA
CGGCACGCGATTGGAGCTCCAGTGCGCCGGGCAAGCCCAGGCTCTCGCGAACCACAACTTTCCTGCCGGC
AAGACCTTTTACTGGTCGCCCGACAGCTGCGGCGACGTGATCTTCCAGATTGAGGCGGGCGACCAGGTAC
TCACAAAGCGATATGCTGGACCCCAGGCATTCCCGGACTTTCTACGCGAGTTCGCCAGCGGGCATCGCAC
GTTTGCGGCCGGAGAGTTTCCCGGCGAGAAAGATGCGCTGGCTCGCATGGGGATCACCTCAATCCGGGTA
AGCTACCAGTTCACCGGCAGTCAGCAGGTGATCAGGCAGGGCGGCGCCATGGCCGGAGCCACGGCTCCAC
GGATGATCGCCCGGTGCTGGTAG
 Primer design