SecReT6
Protein ID: 401764114
SecReT6 ID686
T6SS typei3
Gene symbol-
Locus tagECENHK_13230
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]2801659..2805279 [-]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDJ7GLS1
KEGG IDeno:ECENHK_13230
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.20E-100, Aligned region: 208..483
ImcF-related_N [PF14331], Evalue: 4.20E-100, Aligned region: 762..816
IcmF-related [PF06761], Evalue: 5.00E-91, Aligned region: 531..836
DUF1215 [PF06744], Evalue: 2.60E-29, Aligned region: 947..1072
AAA_16 [PF13191], Evalue: 0.0036, Aligned region: 142..266
AAA_16 [PF13191], Evalue: 0.0036, Aligned region: 815..852
Protein Sequence: 1206 a.a.     [Download]
>gi|401764114|ref|YP_006579121.1| type VI secretion system protein ImpL [Enterobacter cloacae subsp. cloacae ENHKU01]
MLTTLLSILTNRILWSFLGVTALAAVIWMIGPLLSIVDTRPLESEQNRIISIAVVYLLWAQGHILPRLYN
AWLNRKLMDKLNENTTSPEAADPQKRLNSEEQILASRFDEAAQMLKKAHFSKAGQGAQWTQRFSTQYLYQ
LPWYVIIGAPGSGKTTALVNSGLQFPLADRFGKTALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESEQV
QDAGEWLQFMGLLRKYRRRQPINGVIVTISISDLLTQSAEASRQQAVNLRQRLSELHEQLGIRFPVYVMV
TKADLLKGFRAWFADYDKAQRDQIWGFTLPWEQTKHADYDLMGNFQQEFSLLQQRLDAGLPETMLKEHDA
KTRAEAYLFPQEFAALRPLLADYLSTVFARSNFETEFSPRGIYFASGTQEGMPFDRVMGELNRALSLPEG
GESDNWDSVSKDAPIPGAKGQSFFIKNLLQNVIFQEAGIAGENRWWELRNRAVIWSGYAALLALLVILGG
LWLTSYAKNKAYLEEVDAKVPLLDQQSKALQNQPQRDLFDLLPLMNGLVDLPKSDAFDVNDPPVSRRMGL
YRGDDVSDASQSLYQKALDQLLLPAVAMHITTWLRNDNGSDVEYSYEALKAYQMLYQPKHYDGKFLHSWV
MLNLQRNLPQNVTKAQLQQLEWHLTQLLEPKIQASPYAQDASLVARERALINQQPLSTRVYGRLKRLLEH
DENLKPVSLSDLGGPQSELVFSRKSGKSVSDGVPGLYTPDGYWKSFNSQIDSVTTALHEDDAWVLGAATA
QEDKQQIDNAVRQLYMRDFIATWDRFLADIQLNNSADLSQRINTARLLSGANSPLRRLVQNLSQVLTLSR
DTPAPEDAGKAQAQSNRATRTLEALFSNNDTAPTQAAAVTQAPEQLVTDHYAPMIELAQPLEKGGKTIVF
DDFLKQVDELYRYLTAVQDAANSGMPAPGGEAISRLQASAGRLPGGLQTMFSNMAVGASSDTQRRDLENV
RKRINVEVGGFCRQAIAGRYPLVRSASMEVTPDDLARMFAPGTGLMDNFFRDNLTNKVDTTQANWRFMPG
IDGKTLPGSEGLLRPFQQAQSIRDAFFANGATTPSFKVTVRTVRMDNTILNLTLDVDGQLLRYSHGPQAV
QIMNWPGPGGTNQVRMQLGLANGSTATLVTNGAWALNRFFDKASTSPGAGSLSRQATFNVDGHQVTLEFA
PNSIRNPFQLPRFSCP
 
Nucleotide Sequence: 3621 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c2805279-2801659 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGCTGACTACACTTCTTTCCATTCTGACCAACCGCATTCTGTGGAGCTTCCTGGGCGTAACCGCGCTTG
CGGCGGTGATCTGGATGATTGGTCCGCTGTTGTCCATTGTGGATACCCGACCCCTGGAATCTGAACAGAA
CCGCATTATCAGTATTGCTGTGGTCTATCTGCTCTGGGCGCAGGGACACATTCTGCCGCGTCTCTATAAC
GCCTGGCTGAACCGCAAGCTGATGGACAAGCTCAACGAGAACACCACCAGCCCGGAAGCGGCGGATCCGC
AGAAACGCCTGAACAGCGAGGAGCAAATCCTTGCCAGCCGTTTCGATGAAGCCGCGCAGATGCTCAAAAA
AGCGCACTTCAGCAAAGCAGGACAGGGCGCCCAGTGGACGCAACGCTTCAGCACGCAATACCTGTATCAA
CTGCCATGGTACGTGATTATTGGCGCACCGGGCTCCGGTAAAACCACGGCGCTGGTTAACTCCGGACTGC
AATTCCCGCTGGCTGACCGCTTCGGTAAGACCGCGCTGCGGGGTATCGGCGGTACGCGCAACTGCGACTG
GTGGTTCACCAACGAGGCTGTGCTGCTCGACACGGCGGGCCGCTATACCACGCAAGAAAGCGAGCAGGTG
CAGGATGCCGGTGAATGGCTGCAGTTCATGGGGTTACTGCGTAAGTACCGTCGTCGTCAGCCGATCAACG
GCGTCATTGTCACCATCAGCATCTCTGATCTGCTCACCCAGTCTGCGGAGGCGTCACGCCAGCAGGCGGT
GAATCTGCGCCAGCGTCTTTCTGAGCTGCATGAGCAGCTGGGTATCCGCTTCCCGGTTTACGTGATGGTC
ACCAAAGCTGACCTGCTCAAAGGTTTCCGTGCGTGGTTTGCCGACTACGACAAAGCGCAGCGGGACCAGA
TTTGGGGCTTTACGCTGCCGTGGGAGCAGACTAAACACGCCGATTACGACCTGATGGGCAACTTCCAGCA
AGAGTTCTCGCTCTTGCAGCAGCGCCTCGATGCCGGGCTGCCGGAAACCATGCTGAAAGAGCATGACGCG
AAAACCCGTGCTGAAGCGTATCTCTTCCCGCAGGAGTTCGCCGCATTGCGTCCGCTGCTGGCGGATTACC
TGAGCACGGTCTTCGCCCGCTCCAACTTTGAAACCGAGTTCTCTCCGCGTGGGATCTACTTTGCCAGCGG
CACCCAGGAAGGGATGCCGTTTGACCGCGTAATGGGCGAACTGAACCGTGCGCTCTCTCTGCCGGAAGGG
GGAGAGAGTGATAACTGGGATTCGGTAAGTAAAGACGCGCCGATCCCTGGGGCGAAAGGCCAAAGCTTCT
TTATTAAAAACCTGCTGCAAAACGTCATTTTCCAGGAAGCCGGCATTGCCGGAGAAAACCGCTGGTGGGA
ACTGCGTAACCGGGCGGTGATCTGGTCCGGCTATGCGGCGCTGCTGGCCCTGCTGGTGATACTCGGCGGG
CTGTGGCTGACCAGCTATGCCAAAAATAAGGCCTATCTGGAAGAGGTGGATGCGAAGGTGCCGCTGCTGG
ATCAGCAGAGCAAAGCCTTGCAGAACCAGCCGCAGCGCGATCTGTTCGATCTGCTGCCGCTGATGAATGG
TCTGGTTGATCTGCCAAAAAGCGATGCGTTTGATGTAAACGATCCGCCGGTTTCCCGTCGCATGGGGCTC
TACCGCGGAGATGACGTCAGCGATGCCTCTCAGTCTCTGTACCAGAAAGCGCTGGATCAGCTGCTGTTGC
CAGCGGTCGCCATGCACATCACCACCTGGCTTCGCAACGATAATGGCAGCGACGTGGAGTACAGCTATGA
AGCGCTGAAAGCCTATCAGATGCTTTACCAGCCGAAGCACTACGACGGCAAATTCCTGCATTCATGGGTG
ATGCTCAATCTGCAGCGTAACCTGCCGCAGAACGTGACGAAAGCGCAGCTGCAACAGCTTGAATGGCACC
TGACGCAGTTGCTGGAGCCGAAAATTCAGGCTTCGCCGTACGCGCAGGACGCGTCCCTGGTGGCGCGTGA
ACGCGCGCTGATCAATCAGCAGCCGTTATCCACTCGCGTGTATGGTCGTCTTAAGCGTCTGCTGGAGCAT
GACGAAAACCTTAAGCCGGTCTCCCTTTCCGACCTGGGCGGACCGCAGAGCGAGCTGGTGTTTTCACGCA
AAAGCGGCAAGTCGGTAAGCGACGGCGTGCCGGGTCTTTATACGCCAGACGGTTACTGGAAAAGCTTTAA
CAGCCAGATCGACAGCGTGACCACCGCACTGCATGAAGACGACGCCTGGGTGTTGGGCGCCGCGACGGCG
CAGGAGGATAAACAGCAGATTGACAACGCCGTGCGTCAGCTCTACATGCGCGACTTTATCGCTACCTGGG
ATCGCTTTCTCGCCGACATTCAGCTTAACAACAGCGCCGATCTTTCCCAGCGCATCAATACAGCGCGTCT
GCTCTCAGGCGCAAACTCACCCCTGCGCCGTCTGGTGCAGAACCTGAGCCAGGTGCTGACGCTGTCGCGC
GATACGCCAGCCCCGGAAGACGCCGGTAAAGCGCAGGCGCAGAGCAACCGTGCCACCCGCACGCTGGAAG
CGCTGTTCAGCAATAATGACACTGCCCCGACGCAGGCCGCTGCCGTTACCCAGGCTCCGGAACAGCTGGT
GACGGACCACTACGCCCCGATGATTGAGCTGGCCCAGCCGCTGGAGAAGGGGGGCAAGACCATCGTCTTT
GATGATTTTCTTAAGCAGGTGGATGAGCTTTATCGTTACCTGACCGCCGTACAGGATGCCGCCAACAGCG
GCATGCCAGCGCCGGGCGGCGAGGCGATCAGCCGTCTGCAGGCCAGCGCCGGTCGTCTGCCGGGTGGGCT
GCAGACCATGTTCAGCAATATGGCGGTAGGTGCCAGCAGCGATACCCAGCGCCGCGATCTGGAGAACGTG
CGTAAGCGGATTAACGTCGAAGTGGGCGGGTTCTGCCGCCAGGCAATTGCCGGGCGTTATCCGCTGGTGC
GTAGCGCCAGCATGGAAGTTACCCCAGACGACCTCGCCCGCATGTTTGCGCCAGGTACCGGGCTGATGGA
CAACTTCTTTCGCGACAACCTGACCAATAAAGTCGATACCACCCAGGCAAACTGGCGCTTTATGCCGGGC
ATCGACGGTAAAACGCTGCCGGGAAGTGAAGGGCTGCTGAGACCGTTCCAGCAGGCCCAGTCGATTCGCG
ACGCTTTCTTTGCGAATGGTGCCACCACGCCGTCTTTCAAGGTCACGGTACGCACCGTGCGAATGGATAA
CACCATCCTGAACCTGACGCTGGACGTTGACGGCCAGCTGCTGCGCTACAGCCACGGTCCGCAAGCCGTT
CAAATCATGAACTGGCCGGGGCCGGGCGGCACCAACCAGGTCCGCATGCAGCTGGGGCTGGCTAACGGCA
GCACGGCGACGCTGGTGACCAACGGTGCCTGGGCACTCAACCGCTTTTTCGACAAAGCGAGCACCAGCCC
GGGCGCCGGTAGCCTGAGCCGTCAGGCCACCTTCAACGTCGACGGACATCAGGTCACGCTGGAGTTTGCG
CCAAACAGCATTCGCAATCCGTTCCAGCTACCCCGTTTCTCATGCCCATAA
 Primer design