SecReT6
Protein ID: 401764620
SecReT6 ID687
T6SS typei2
Gene symbol-
Locus tagECENHK_15810
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]3373141..3376596 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDJ7GIJ9
KEGG IDeno:ECENHK_15810
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.40E-68, Aligned region: 426..744
DUF1215 [PF06744], Evalue: 2.40E-35, Aligned region: 867..987
Protein Sequence: 1151 a.a.     [Download]
>gi|401764620|ref|YP_006579627.1| ImcF domain-containing protein [Enterobacter cloacae subsp. cloacae ENHKU01]
MEKDNALKPDTSISTAATVTIALAVVTLAILFGGLFYWYFAVDLSLDWESVRPVLIACSIFWIALVCLLA
LGFLGAQLWQICRIKKFATQGERDSRGEQKRKEQGLKAEIARFLRKRYTLFWRHKVRLLLVTGDEAAIEQ
LVPGLRQQQWLEGNRTVLIYGGSLASEPDREKYTALRKLRRSRPLDGIIRVIPQSLSLTPQISDSDLRGL
EQISELLRYSAPVWLWQLCDSKWSQAKRPEQTVGATFPLRAKEEDIFRQLELMLPTLRAQGMSQIAENNS
HDALLRLGQNLKDDGIARWAQQLLPWLSVSQQRIPLRGLMFSLPENKPADTSEKTTDPEKYIPESQQHAL
TLPVTWQGIVDDCTRVRGRRVGMAWEQTLAWTLMVILGIWGAGTLLSFSLNYGQISSVAGKARNLVEHPS
VSDYQLTGLHDLRNDAGRLLHNVQEGSPWYQRFGLDHNQQLLDALLPWYGVANNRLIRDPANAALAQKLT
ALVGSAPGSDQRAQLAKPGYDQLKAWLMMARPDKADGAYYAQTMKSVQPTRMGISTGLWQSLSPDLWAFY
ITELPEQPQWKITPDAQLVSQSRQVLLQQIGRRNAESTLYENMLKSVRRNFADISLEDMTSGTDARRLFT
TEEVVPGMFSRQAWEGGVQQAIEKAARSRRDEIDWVLSDSHKAVSADLSPEALKARLTERYFTDFAGSWL
SFLNSLQLNPTNNIADVTDQLTLMSDVRQSPMIALMNTLAWQGQTGQQSEGLSDSILKSAKDLVGGKDKP
AIDQSASGPQGPLDETFGPLLQLLGKNKGSNVMSADNSLSLQTYLTRITRVRLRLQQVANASDPQEMMQT
LAQTVFQGKSVDLTDTQQYGSLISASLGEEWSGFGSTMFVQPLTQAWETVLQPSAASLNDKWSRSVVANW
HTAFDGRFPFAASKSDVSLPMLAEFIRKDSGRIERFLNTELSGVLHKEGSQWVPDKVNSQGLNFNPAFLR
AINQLTQLSDILFTDGSQGISFELQARPVPQVVETQLTIDGQKLHYFNQMADWQSFRWPGETYKPGTMVT
WTTVNAGARLFGDYSGTWGFIRWLDQSKRQQLDRSQWMMNFTAPDGRTLQWVLRSQLGSGPLALLALRGF
TLPDEIFSVDSAATAQALMANTEDNDMDESE
 
Nucleotide Sequence: 3456 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c3376596-3373141 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGGAAAAGGATAATGCCCTTAAACCAGACACGAGTATCTCGACTGCCGCAACGGTGACTATTGCGCTTG
CGGTTGTCACTTTGGCGATACTTTTTGGAGGTCTCTTCTACTGGTATTTCGCTGTTGATCTCTCGCTGGA
CTGGGAATCGGTTCGGCCCGTACTGATTGCCTGCAGTATTTTCTGGATTGCGTTAGTTTGTCTCCTTGCG
CTGGGTTTTCTTGGGGCTCAGCTGTGGCAGATATGTCGAATCAAGAAATTCGCGACGCAAGGAGAGAGAG
ACAGCCGTGGCGAGCAAAAGCGCAAAGAGCAGGGATTGAAAGCCGAAATCGCGCGTTTTTTGCGTAAACG
CTACACCCTTTTCTGGCGCCACAAGGTCCGCCTGTTGCTGGTCACCGGCGACGAAGCCGCCATTGAACAA
CTGGTTCCAGGCCTTCGGCAGCAGCAGTGGCTTGAAGGCAACCGTACCGTTCTGATTTACGGTGGGAGCC
TGGCATCTGAGCCCGATCGTGAAAAATACACCGCGCTACGTAAACTGCGTCGGAGTCGTCCTCTGGACGG
TATTATCCGCGTTATACCGCAATCGCTTAGCCTGACCCCACAAATCAGTGACAGCGATTTACGCGGCCTG
GAACAAATCAGTGAGCTGCTGCGCTATTCAGCACCGGTCTGGCTGTGGCAACTGTGCGACAGCAAGTGGT
CACAGGCAAAACGCCCTGAGCAAACGGTGGGGGCTACTTTTCCCCTGCGCGCTAAAGAAGAAGATATTTT
CCGTCAGCTTGAACTGATGCTGCCGACTCTGCGGGCACAGGGGATGAGTCAAATCGCCGAAAACAACAGT
CACGATGCCCTGTTGCGCCTGGGCCAAAACCTTAAAGACGACGGTATCGCCCGTTGGGCTCAGCAACTGT
TGCCGTGGCTCTCAGTTTCTCAGCAGCGTATTCCACTGCGTGGCCTGATGTTTAGCCTGCCGGAGAATAA
ACCAGCCGATACGTCAGAGAAAACGACCGACCCTGAGAAATATATCCCGGAATCACAGCAGCATGCCCTG
ACTCTGCCGGTGACCTGGCAGGGTATCGTTGACGACTGTACCCGTGTGCGTGGCCGCCGTGTCGGTATGG
CGTGGGAACAAACCCTTGCCTGGACGCTGATGGTAATTCTCGGAATCTGGGGTGCGGGTACGCTGCTGTC
GTTTTCACTGAACTACGGACAAATCTCCTCTGTCGCAGGAAAAGCCCGCAACCTGGTTGAACATCCTTCC
GTATCCGACTATCAGCTGACGGGACTCCATGACCTGCGAAATGACGCAGGCCGCCTGCTGCACAATGTTC
AGGAGGGGAGTCCGTGGTATCAGCGCTTTGGCCTTGACCATAACCAGCAGTTGCTCGATGCGTTGCTGCC
CTGGTACGGCGTGGCGAACAACCGCCTGATTCGCGACCCGGCAAATGCCGCCCTGGCACAGAAGCTCACT
GCGCTGGTAGGCTCAGCGCCCGGCAGCGATCAGCGGGCGCAATTGGCGAAGCCGGGGTATGACCAGCTGA
AAGCCTGGCTGATGATGGCTCGCCCGGATAAAGCCGACGGCGCGTATTACGCCCAGACGATGAAAAGCGT
GCAGCCTACGCGCATGGGCATTTCAACCGGCCTGTGGCAAAGCCTGTCGCCGGACTTGTGGGCCTTTTAC
ATCACCGAACTGCCTGAGCAGCCACAGTGGAAAATCACGCCGGATGCGCAGCTGGTCAGCCAGAGTCGTC
AGGTGCTGCTCCAGCAGATTGGCCGCCGCAATGCAGAAAGTACGCTGTATGAGAACATGCTCAAATCCGT
GCGTCGTAACTTTGCAGATATCTCTCTGGAAGACATGACCAGCGGTACCGATGCGCGACGACTGTTCACC
ACCGAGGAGGTGGTGCCGGGCATGTTCTCTCGTCAGGCATGGGAAGGTGGCGTTCAGCAGGCCATAGAGA
AAGCAGCCCGTTCACGTCGGGATGAAATCGACTGGGTACTCAGTGATTCACACAAGGCTGTATCGGCCGA
CCTGTCGCCGGAAGCGCTCAAAGCCCGTCTGACAGAACGTTACTTTACCGACTTTGCTGGCAGCTGGTTG
AGCTTCCTCAACAGCCTGCAACTCAATCCGACAAACAATATTGCCGATGTGACCGACCAGTTGACCCTGA
TGAGTGATGTCCGCCAGTCTCCGATGATTGCCCTGATGAATACCCTCGCCTGGCAGGGACAGACCGGCCA
GCAAAGCGAAGGTCTTTCGGATTCGATCCTCAAATCGGCTAAGGATCTGGTAGGTGGAAAAGACAAGCCT
GCGATTGACCAGTCTGCGTCAGGGCCGCAGGGGCCGCTGGATGAAACCTTCGGACCGCTGCTTCAGCTCT
TGGGTAAAAATAAAGGCAGCAACGTCATGTCGGCTGACAACTCGCTGAGCCTGCAGACGTACCTGACCCG
CATCACCCGGGTACGCCTGCGCCTGCAGCAGGTTGCAAACGCCTCAGATCCGCAGGAGATGATGCAAACC
CTGGCGCAGACCGTGTTCCAGGGCAAAAGCGTGGATCTGACTGACACTCAGCAGTATGGCAGCCTGATTT
CGGCAAGCCTTGGCGAAGAGTGGAGCGGGTTTGGCAGCACGATGTTTGTGCAGCCGCTGACTCAGGCCTG
GGAGACCGTGCTTCAGCCGTCTGCGGCCAGCCTGAATGATAAGTGGAGCCGTTCAGTCGTGGCGAACTGG
CACACGGCATTTGACGGACGCTTCCCGTTTGCGGCGAGTAAGAGTGATGTTTCCTTGCCGATGCTTGCCG
AGTTTATACGTAAGGACAGCGGGCGTATTGAACGCTTTCTGAATACGGAACTTAGCGGTGTATTGCACAA
AGAAGGCAGCCAGTGGGTGCCGGATAAGGTCAACAGTCAGGGGTTAAACTTTAATCCGGCGTTTCTGCGC
GCCATTAATCAGCTGACCCAGCTGTCGGACATTCTGTTTACCGATGGCAGTCAGGGCATCAGCTTTGAAC
TGCAGGCACGTCCGGTACCACAGGTTGTGGAAACGCAACTGACGATTGATGGGCAAAAGCTGCACTACTT
TAACCAGATGGCTGACTGGCAGTCCTTCCGCTGGCCGGGAGAGACTTATAAGCCGGGAACCATGGTGACC
TGGACCACGGTTAACGCAGGGGCGCGTCTCTTCGGCGACTACAGCGGAACCTGGGGCTTTATTCGCTGGC
TGGATCAGAGCAAGCGTCAGCAGCTCGACCGCAGTCAATGGATGATGAATTTCACCGCCCCGGATGGTCG
CACCCTGCAATGGGTATTGCGTTCACAGCTTGGCAGTGGGCCGCTGGCGCTACTGGCTTTGCGCGGCTTC
ACGCTGCCGGATGAGATCTTCAGCGTTGACAGCGCGGCCACGGCTCAGGCGCTGATGGCGAACACCGAAG
ACAACGACATGGACGAAAGCGAATAA
 Primer design