SecReT6
Protein ID: 402567779
SecReT6 ID688
T6SS typei4b
Gene symbol-
Locus tagGEM_3034
StrainBurkholderia cepacia GG4
Repliconchromosome I [GenBank: NC_018513] [Browse all T6SS(s) in this replicon]
Location [Strand]3314859..3318800 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDJ7J5Y8
KEGG IDbct:GEM_3034
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.10E-72, Aligned region: 193..451
IcmF-related [PF06761], Evalue: 5.20E-52, Aligned region: 498..876
DUF1215 [PF06744], Evalue: 3.00E-29, Aligned region: 1009..1124
DUF4229 [PF14012], Evalue: 0.0053, Aligned region: 17..73
Protein Sequence: 1313 a.a.     [Download]
>gi|402567779|ref|YP_006617124.1| type VI secretion protein IcmF [Burkholderia cepacia GG4]
MQRILNVLTHPRTLSIVGIVALAAILFIVADMLQLPLLWAAIAFAAILALWLGVALWRRWRVKRANQQLG
QVLEEQAETGKIAAPAAAALAPDAKTADLDVLRTRLSDAVKTIKTSKIGQVSGGSALYELPWYIVIGNPA
AGKSSAVLNSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLGLLKRY
RPKAPINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSS
DKHEYDRVWGATLPYEPDDKRDVVAQFDTHFEELYEGLKEISIAQLSLSRGNQLSPGQLSFPLEFSTIKP
SLRAFLATLFENNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAHRFGLDANALPKPHSAFSKNGFFLRD
LFSKVIFADRQTVRQFASPTKTRLRYATFFGFVAALALALGGWTWSTIGNQQLVANVQADLDNVTRLQQG
RNDLQSRLQAMDILEDRIEQLEQFRRDKPVSVSLGLYQGDRLEQHLLTEYYNGVRQILLAPVSQNLASFM
KDVNAHPEQLVPMTRPPESGAVQGGALPVSTNPPGAAPLAAAAPGASAATAAAPQAPAAPQGGLYSDASP
TNVQDAYNALKTYLMLSDKRHVEQAHLTDQLARFWRGWLETNRGNMPRDEMIKSAERMISFYLARVNDND
WPMIDANLALVDQTRENLRRVVRGMPARQRVYEEIKARASTRFAPMTIARIVGDGNQALIAGSYAIPGTF
TREAWFDYVQPAIRDAATKELQAKDWVLNTSTQDDLTLEGSPEQIQKTLVGMYKTEYAQHWQKFMQGIAV
QGFSSFGQAVDGMNRLGDPQDSPIRKVLETAYDQTSWDNPSLANVAIKKAQTGVVNWVKQLFTRSPAGQV
AAANIDINGNPAEVPMGPIGQEFIGLARIVATHDGTSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLM
QQTLDGNGSELADSLKFVDEQMLTGLTDSQRKSLRPLLVRPLMQAFSVVIQPASAEVNKVWNAQVYQPFQ
NSLATKYPFAANAKVEAGAGEIAQVFGPDGSIAKFVGSTLGPLAVRRGDTLAARTWGDMGIGLTPDFTNG
FARWVAPLAGGAAGGAAAAAEPQTVFQILPQPSTGTTEYTVAIDGQQLRYRNTPPQWTNFVWPNPQGSPG
ATLSATTFDGRTVQLVNEPGRYGLEKLINSAQRKRRPDGTFDLTWVQGSVNVSVTMRIISTSQPTGGGGD
QPQQQSLRGLQLPSSVADASAGAAQNATQAGTGAPAAAPAVTAATATNAQEAQ
 
Nucleotide Sequence: 3942 bp     [Download]
>gi|402564811|ref|NC_018513.1|:3314859-3318800 Burkholderia cepacia GG4 chromosome 1, complete sequence
ATGCAACGCATCCTCAACGTGCTGACTCATCCGCGTACGCTCTCGATTGTCGGGATCGTCGCGCTAGCGG
CGATTCTCTTCATCGTCGCCGACATGCTGCAGCTGCCGCTCCTGTGGGCGGCGATCGCCTTCGCGGCGAT
CCTCGCGCTGTGGCTCGGCGTCGCGTTGTGGCGCCGCTGGCGCGTGAAGCGCGCGAACCAGCAGCTCGGC
CAGGTGCTGGAAGAGCAGGCGGAAACCGGCAAAATCGCCGCGCCGGCTGCGGCCGCCCTCGCCCCCGACG
CGAAAACGGCCGACCTCGACGTGCTGCGCACGCGCCTGTCCGACGCGGTGAAGACGATCAAGACGTCGAA
GATCGGCCAGGTGTCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAACCCCGCC
GCGGGCAAGAGCAGCGCGGTGCTCAATTCCGGCCTGCAGTTCCCGTTCGCGGACAAGAACAGCGCCGTGA
TCCACGGCATCGGCGGCACGCGCAACTGCGACTGGTTCTTCACGACCGAAGGGATCCTGCTCGACACGGC
CGGCCGCTATTCGGTGCACGAGGAAGACCGCAGCGAGTGGCTCGGCTTCCTCGGCCTGCTGAAGCGCTAC
CGGCCGAAGGCGCCGATCAACGGCATCATCGTCACCGCGAGCATCGCCGAACTCACCGGCAACCGCCCCG
AATTTGCGATCAACCTCGCGAAAAACCTGCGTCAGCGCGTTCAGGAGCTGACCGAGAAGCTCGAGGTGTT
CGCGCCGGTCTACGTGATGTTCACCAAGGCCGACCTGATCACCGGCTTCACCGAATTCTTCAGCAGCAGC
GACAAGCACGAATACGACCGCGTGTGGGGCGCCACCCTGCCCTACGAGCCCGACGACAAGCGCGACGTGG
TCGCGCAGTTCGACACGCACTTCGAGGAACTCTACGAAGGGCTGAAGGAAATCAGCATCGCGCAGCTGTC
GCTGTCGCGCGGCAACCAGTTGTCACCGGGCCAGCTGAGCTTCCCGCTCGAATTCTCGACGATCAAGCCG
TCGCTGCGCGCGTTCCTCGCGACGCTGTTCGAAAACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCT
TCTACTTCACGAGCGCGCTGCAGGAAGGCGAAACCAACAGCGCTGCCGCGCAGCGCATCGCGCACCGCTT
CGGCCTCGACGCGAACGCGCTGCCGAAGCCGCACAGCGCGTTCTCGAAGAACGGCTTCTTCCTGCGCGAC
CTGTTCTCGAAGGTGATCTTCGCCGACCGTCAGACCGTGCGCCAGTTCGCGAGCCCGACCAAGACACGGC
TGCGCTACGCGACCTTCTTCGGCTTCGTCGCCGCACTCGCGCTTGCGCTCGGCGGCTGGACCTGGTCGAC
CATCGGCAACCAGCAGCTCGTCGCGAACGTACAGGCCGACCTCGACAACGTCACGCGCCTGCAGCAGGGC
CGCAACGACCTGCAGTCGCGCCTGCAGGCGATGGACATCCTCGAGGACCGGATCGAGCAGCTCGAGCAGT
TCCGCCGCGACAAGCCGGTGTCGGTGTCGCTCGGCCTGTACCAGGGCGACCGTCTCGAGCAGCATCTGCT
GACCGAGTACTACAACGGCGTACGCCAGATCCTGCTGGCACCGGTCTCGCAGAACCTCGCATCGTTCATG
AAGGACGTGAACGCGCACCCCGAACAGCTCGTGCCGATGACGCGCCCGCCCGAATCGGGCGCCGTGCAGG
GCGGCGCGCTGCCGGTCTCGACGAACCCGCCGGGCGCCGCACCGCTCGCCGCTGCCGCACCAGGCGCATC
CGCCGCGACGGCCGCCGCGCCGCAAGCGCCGGCCGCGCCGCAAGGCGGGCTGTACAGCGACGCCTCGCCG
ACCAACGTGCAGGACGCGTACAACGCGCTGAAAACCTACCTGATGCTGTCCGACAAGCGTCACGTCGAGC
AGGCGCACCTGACCGACCAGCTCGCGCGCTTCTGGCGCGGCTGGCTCGAGACGAATCGCGGCAACATGCC
GCGCGACGAGATGATCAAGAGCGCCGAGCGCATGATCTCGTTCTATCTCGCCCGCGTGAACGACAACGAC
TGGCCGATGATCGACGCGAACCTCGCGCTCGTCGACCAGACCCGCGAGAACCTGCGCCGCGTCGTGCGCG
GGATGCCGGCCCGCCAGCGCGTCTACGAGGAAATCAAGGCACGTGCGTCGACCCGCTTCGCGCCGATGAC
CATCGCGCGCATCGTCGGCGACGGCAACCAGGCGCTGATCGCCGGCAGCTATGCGATCCCGGGCACCTTC
ACGCGCGAAGCGTGGTTCGACTACGTGCAGCCGGCGATCCGTGACGCCGCGACCAAGGAACTGCAGGCGA
AGGACTGGGTGCTGAACACCTCGACGCAGGACGACCTGACGCTGGAAGGCAGCCCCGAGCAGATCCAGAA
GACGCTCGTCGGCATGTACAAGACCGAGTACGCGCAGCACTGGCAGAAGTTCATGCAGGGCATCGCGGTG
CAGGGCTTCAGCAGCTTCGGCCAGGCCGTCGACGGGATGAACCGCCTCGGCGACCCGCAGGATTCGCCGA
TCCGCAAGGTCCTCGAGACCGCGTACGACCAGACGTCGTGGGACAACCCGTCGCTCGCGAACGTGGCGAT
CAAGAAGGCGCAGACGGGTGTCGTGAACTGGGTCAAGCAGTTGTTCACGCGCTCGCCGGCCGGCCAGGTG
GCGGCCGCGAACATCGACATCAACGGCAATCCGGCCGAGGTGCCGATGGGTCCGATCGGCCAGGAGTTCA
TCGGGCTCGCACGGATCGTCGCGACGCACGACGGCACGTCGATGCTCAAGGGCTACATGGACACGCTGTC
GAAGGTCCGGACGCGCTTCAACGTGATCAAGAACCAGGGCGACCCCGGCCCCGGCGCGCGCCAGCTGATG
CAGCAGACGCTCGACGGCAACGGCTCGGAACTCGCCGATTCGCTGAAGTTCGTCGACGAGCAGATGCTGA
CGGGCCTCACCGATTCGCAACGCAAGTCGCTGCGCCCGCTGCTGGTGCGGCCGCTGATGCAGGCGTTCTC
GGTGGTGATCCAGCCGGCCAGCGCCGAAGTCAACAAGGTGTGGAACGCGCAGGTCTACCAGCCGTTCCAG
AACTCGCTCGCGACCAAGTACCCGTTCGCGGCAAATGCGAAGGTCGAGGCCGGCGCCGGTGAAATCGCGC
AGGTGTTCGGTCCGGACGGTTCGATCGCGAAGTTCGTCGGCTCGACGCTGGGCCCGCTCGCGGTGCGCCG
CGGCGACACGCTCGCGGCCCGCACGTGGGGCGACATGGGCATCGGCCTCACGCCCGACTTCACGAACGGC
TTCGCGCGCTGGGTCGCCCCGCTCGCCGGCGGTGCTGCAGGCGGCGCAGCCGCTGCGGCCGAACCGCAGA
CCGTGTTCCAGATCCTGCCGCAGCCGAGCACGGGCACGACCGAATACACGGTCGCGATCGACGGGCAGCA
GCTGCGCTACCGCAACACGCCGCCGCAGTGGACCAACTTCGTGTGGCCGAACCCGCAGGGCTCGCCGGGC
GCGACGCTGTCCGCGACGACCTTCGACGGCCGCACGGTGCAGCTCGTCAACGAGCCGGGCCGCTACGGTC
TGGAGAAGCTGATCAACTCGGCGCAGCGCAAGCGCCGGCCGGACGGCACCTTCGACCTCACGTGGGTCCA
GGGCAGCGTGAACGTGTCGGTGACGATGCGCATCATCAGCACGTCGCAGCCGACGGGCGGCGGCGGCGAC
CAGCCGCAGCAGCAGAGCCTGCGCGGCCTGCAGCTGCCGTCGTCGGTCGCCGACGCGAGCGCGGGCGCCG
CGCAGAACGCGACGCAGGCCGGCACGGGCGCGCCGGCCGCAGCACCGGCCGTCACGGCCGCCACCGCAAC
GAATGCCCAGGAGGCGCAATGA
 Primer design