SecReT6
Protein ID: 402568943
SecReT6 ID689
T6SS typei3
Gene symbol-
Locus tagGEM_4203
StrainBurkholderia cepacia GG4
Repliconchromosome II [GenBank: NC_018514] [Browse all T6SS(s) in this replicon]
Location [Strand]1123167..1125371 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDJ7JGV9
KEGG IDbct:GEM_4203
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-88, Aligned region: 24..325
Phage_GPD [PF05954], Evalue: 3.00E-88, Aligned region: 610..640
Phage_base_V [PF04717], Evalue: 5.80E-24, Aligned region: 364..456
Phage_base_V [PF04717], Evalue: 5.80E-24, Aligned region: 655..671
Gp5_C [PF06715], Evalue: 4.60E-13, Aligned region: 511..527
Gp5_C [PF06715], Evalue: 4.60E-13, Aligned region: 525..547
Gp5_C [PF06715], Evalue: 4.60E-13, Aligned region: 556..579
Gp5_C [PF06715], Evalue: 4.60E-13, Aligned region: 581..603
Gp5_C [PF06715], Evalue: 4.60E-13, Aligned region: 611..634
Gp5_C [PF06715], Evalue: 4.60E-13, Aligned region: 644..664
Gp5_C [PF06715], Evalue: 4.60E-13, Aligned region: 700..718
Protein Sequence: 734 a.a.     [Download]
>gi|402568943|ref|YP_006618287.1| Rhs element Vgr protein [Burkholderia cepacia GG4]
MNRVFTLDSPHGDDLTFHTLDGCEALGQLFEFRIEALADSHSLSLKDLLGKPVTVRIEQQDLSTRYLNGI
VARASLAGRRAERHYGYELVVRPWLWLATRRSDCRIFQNRTVPDIVQEVLAPYGFPIENKLTEAYVPREY
CVQYNETDTAFVTRLMEFEGIYFHFRHAADHHTLVLSDAMSSHVALPGYETIPYIAPDRTAIADEEHIDG
WLPAQEVSVGKHQTTDYDYTKPRADLSSQKVDPRGHDHDSFASFEWPGGYRDDTPGAHYSRVRLEEQQAE
HERASADTDVRGVAPGYVFTLEHCPRADQNREYLIVRCRYRFQENAYASDQGAEAVVHRTIMLVQPSSLP
FRSPRDTPRPRTSGPQTATVVGPPGEEIWTDQYGRVKLQFRWDRYGQSNQDSSCWVRVSSPWAGGGFGGV
QIPRVGDEVVVDFLNGDPDEPIVTGRVFNGEKMPPWGLPGSATQSGLLSRSSPGGTTDHANAFRFEDKKG
AEQLWMHAERNFDAETELDHSLSVGNNHTHTVGNDETMQVNHNRQRSVGQNETVNIGQHRVAQVGGNETH
AVAGNRTRSVGQNETVTISANRDATIGGTHSETVAKGKTETIGEGKTLNVGQMYQTTSQDMTTLVASSHT
EEIGARTSTIAKAHTLTVGGEHTVNVGANHTTNVQHQVLVAAGDQLMLMCGASSILMKRDGTIAIQGINV
TSTGTESHSVNGKTVTSSATGEHTVEGTILKLNP
 
Nucleotide Sequence: 2205 bp     [Download]
>gi|402567932|ref|NC_018514.1|:c1125371-1123167 Burkholderia cepacia GG4 chromosome 2, complete sequence
GTGAATCGCGTATTCACACTCGACAGCCCGCACGGCGACGACTTGACGTTCCACACGCTCGACGGCTGCG
AGGCACTCGGCCAGTTGTTCGAATTCCGGATCGAGGCGCTCGCCGACAGTCACAGCCTGTCGCTGAAGGA
CCTGCTCGGCAAGCCCGTGACGGTCCGCATCGAACAGCAGGACCTGTCGACGCGCTACCTGAACGGGATC
GTCGCGCGGGCGTCGCTCGCCGGCCGGCGAGCGGAGCGGCACTACGGTTACGAGCTGGTGGTGCGGCCGT
GGCTGTGGCTCGCGACGCGCCGCTCCGACTGCCGGATCTTCCAGAACCGCACCGTGCCCGACATCGTGCA
GGAAGTGCTGGCGCCTTACGGTTTCCCCATCGAGAACAAGCTGACCGAAGCGTATGTGCCGCGCGAATAC
TGCGTGCAGTACAACGAGACCGACACTGCATTCGTGACGCGGCTGATGGAGTTCGAGGGCATCTATTTCC
ATTTCAGGCACGCGGCGGACCATCACACGCTCGTGCTGAGCGACGCGATGTCGTCGCACGTCGCGTTGCC
CGGTTACGAAACGATCCCGTACATCGCACCGGATCGAACCGCGATCGCCGATGAGGAACACATCGACGGC
TGGCTGCCCGCGCAGGAGGTTAGCGTCGGCAAGCATCAGACCACCGACTACGACTATACGAAGCCGCGCG
CCGATCTTTCATCGCAGAAGGTCGATCCGCGCGGCCACGACCACGACAGCTTCGCGTCGTTCGAATGGCC
GGGCGGGTATCGCGACGATACGCCCGGTGCGCACTACAGCCGCGTGCGGCTCGAGGAGCAGCAGGCCGAG
CACGAGCGTGCGAGCGCCGATACCGACGTGCGCGGCGTCGCGCCCGGTTATGTGTTCACGCTCGAGCATT
GCCCGCGCGCCGATCAGAATCGCGAGTACCTGATCGTGCGGTGTCGGTACCGTTTTCAGGAGAACGCGTA
TGCGAGCGACCAGGGCGCGGAGGCAGTCGTGCATCGGACCATAATGCTCGTGCAGCCGTCGAGCCTGCCT
TTCCGGTCGCCCCGCGACACGCCGCGGCCGCGGACCAGCGGTCCGCAGACGGCCACCGTCGTCGGGCCGC
CCGGCGAGGAGATCTGGACCGATCAGTACGGGCGCGTGAAGCTGCAGTTTCGCTGGGACCGGTATGGGCA
GAGCAATCAGGATTCGTCGTGCTGGGTGCGCGTGTCGAGCCCGTGGGCCGGCGGCGGCTTCGGGGGCGTG
CAGATTCCGCGGGTCGGCGATGAGGTCGTGGTCGATTTCCTGAACGGCGATCCGGATGAGCCGATCGTCA
CCGGGCGCGTATTCAACGGCGAAAAGATGCCGCCGTGGGGGTTGCCGGGCAGCGCGACGCAAAGCGGGCT
GCTGTCCCGGTCGTCGCCGGGCGGGACGACCGACCATGCGAACGCGTTCCGGTTCGAGGACAAGAAGGGC
GCCGAGCAGCTGTGGATGCATGCGGAGCGGAATTTCGATGCGGAGACCGAACTCGATCATTCGCTTTCCG
TCGGTAACAACCATACGCATACGGTCGGCAACGACGAGACGATGCAGGTGAACCACAACCGGCAACGGAG
TGTGGGGCAGAACGAGACGGTGAATATCGGCCAGCATCGCGTGGCGCAGGTCGGCGGGAACGAGACCCAT
GCGGTGGCGGGAAATCGCACGCGTTCGGTCGGACAGAACGAAACCGTGACGATCTCCGCCAATCGCGACG
CGACCATCGGCGGTACGCACAGCGAGACGGTCGCGAAAGGCAAGACCGAAACCATCGGCGAAGGCAAGAC
GCTGAACGTCGGACAGATGTATCAGACGACGTCGCAGGACATGACGACGTTGGTTGCGTCGTCGCACACC
GAGGAAATCGGTGCGAGGACGTCGACGATTGCGAAAGCGCATACGCTCACGGTCGGTGGAGAACACACCG
TCAACGTTGGCGCGAACCACACGACGAACGTGCAGCATCAGGTGCTCGTCGCGGCCGGCGACCAACTGAT
GCTCATGTGCGGTGCATCGAGCATCCTGATGAAGCGCGACGGCACGATCGCGATCCAGGGCATCAACGTG
ACGTCGACCGGTACGGAAAGCCATAGCGTGAACGGCAAGACGGTGACATCGTCGGCGACGGGCGAGCACA
CCGTCGAAGGCACGATCCTGAAACTGAATCCATGA
 Primer design