SecReT6
Protein ID: 402568944
SecReT6 ID689
T6SS typei3
Gene symbol-
Locus tagGEM_4204
StrainBurkholderia cepacia GG4
Repliconchromosome II [GenBank: NC_018514] [Browse all T6SS(s) in this replicon]
Location [Strand]1125368..1128034 [-]
ProductATP-dependent Clp protease, ATP-binding subunit ClpB
NoteTssH
UniProt IDJ7JE00
KEGG IDbct:GEM_4204
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.70E-38, Aligned region: 228..248
AAA_2 [PF07724], Evalue: 8.70E-38, Aligned region: 616..782
AAA [PF00004], Evalue: 3.40E-18, Aligned region: 230..330
AAA [PF00004], Evalue: 3.40E-18, Aligned region: 621..705
ClpB_D2-small [PF10431], Evalue: 9.20E-12, Aligned region: 788..862
AAA_5 [PF07728], Evalue: 1.10E-11, Aligned region: 230..250
AAA_5 [PF07728], Evalue: 1.10E-11, Aligned region: 620..719
AAA_16 [PF13191], Evalue: 7.10E-10, Aligned region: 33..78
AAA_16 [PF13191], Evalue: 7.10E-10, Aligned region: 207..285
AAA_16 [PF13191], Evalue: 7.10E-10, Aligned region: 491..539
AAA_16 [PF13191], Evalue: 7.10E-10, Aligned region: 613..662
AAA_16 [PF13191], Evalue: 7.10E-10, Aligned region: 685..704
AAA_22 [PF13401], Evalue: 8.90E-09, Aligned region: 230..310
AAA_22 [PF13401], Evalue: 8.90E-09, Aligned region: 370..399
AAA_22 [PF13401], Evalue: 8.90E-09, Aligned region: 617..657
Sigma54_activat [PF00158], Evalue: 8.20E-07, Aligned region: 225..246
Sigma54_activat [PF00158], Evalue: 8.20E-07, Aligned region: 603..734
IstB_IS21 [PF01695], Evalue: 4.40E-06, Aligned region: 214..249
IstB_IS21 [PF01695], Evalue: 4.40E-06, Aligned region: 617..639
Zeta_toxin [PF06414], Evalue: 3.70E-05, Aligned region: 230..250
Zeta_toxin [PF06414], Evalue: 3.70E-05, Aligned region: 618..660
Clp_N [PF02861], Evalue: 7.00E-05, Aligned region: 29..75
Clp_N [PF02861], Evalue: 7.00E-05, Aligned region: 117..129
AAA_25 [PF13481], Evalue: 7.50E-05, Aligned region: 229..254
AAA_25 [PF13481], Evalue: 7.50E-05, Aligned region: 286..321
AAA_25 [PF13481], Evalue: 7.50E-05, Aligned region: 521..548
AAA_25 [PF13481], Evalue: 7.50E-05, Aligned region: 605..642
AAA_17 [PF13207], Evalue: 0.00015, Aligned region: 231..247
AAA_17 [PF13207], Evalue: 0.00015, Aligned region: 388..400
AAA_17 [PF13207], Evalue: 0.00015, Aligned region: 619..656
NACHT [PF05729], Evalue: 0.00017, Aligned region: 230..265
NACHT [PF05729], Evalue: 0.00017, Aligned region: 620..648
FtsK_SpoIIIE [PF01580], Evalue: 0.00037, Aligned region: 223..272
FtsK_SpoIIIE [PF01580], Evalue: 0.00037, Aligned region: 435..519
FtsK_SpoIIIE [PF01580], Evalue: 0.00037, Aligned region: 611..637
AAA_29 [PF13555], Evalue: 0.00055, Aligned region: 222..242
AAA_29 [PF13555], Evalue: 0.00055, Aligned region: 463..474
AAA_29 [PF13555], Evalue: 0.00055, Aligned region: 615..645
AAA_14 [PF13173], Evalue: 0.0017, Aligned region: 290..310
AAA_14 [PF13173], Evalue: 0.0017, Aligned region: 618..702
AAA_18 [PF13238], Evalue: 0.003, Aligned region: 231..250
AAA_18 [PF13238], Evalue: 0.003, Aligned region: 621..649
ResIII [PF04851], Evalue: 0.0037, Aligned region: 216..251
ResIII [PF04851], Evalue: 0.0037, Aligned region: 290..311
ResIII [PF04851], Evalue: 0.0037, Aligned region: 592..642
Hpr_kinase_C [PF07475], Evalue: 0.0044, Aligned region: 178..222
Hpr_kinase_C [PF07475], Evalue: 0.0044, Aligned region: 230..243
Hpr_kinase_C [PF07475], Evalue: 0.0044, Aligned region: 621..637
Arch_ATPase [PF01637], Evalue: 0.0053, Aligned region: 208..244
Arch_ATPase [PF01637], Evalue: 0.0053, Aligned region: 295..313
Arch_ATPase [PF01637], Evalue: 0.0053, Aligned region: 618..634
T2SE [PF00437], Evalue: 0.0077, Aligned region: 215..244
T2SE [PF00437], Evalue: 0.0077, Aligned region: 591..698
AAA_19 [PF13245], Evalue: 0.0091, Aligned region: 227..252
AAA_19 [PF13245], Evalue: 0.0091, Aligned region: 616..642
AAA_19 [PF13245], Evalue: 0.0091, Aligned region: 851..869
Protein Sequence: 888 a.a.     [Download]
>gi|402568944|ref|YP_006618288.1| ATP-dependent Clp protease, ATP-binding subunit ClpB [Burkholderia cepacia GG4]
MSDIGRVNLFGKLNPLLYETLEQATGFCRLRGNPYVELAHWFKQILQRPDGDLQRVLHRFGIDEAAIERG
LVAALDRLPRGAGSVSDLSAHIDDAVERAWVYATLKYDATRIRGAVLLLAILKTPQLRNVLYAIAREFEH
IVPDVLADELEAIVDGSAEAQPAANADAGAGSGDAAMRGAAAVKGSALARFAVDLTARARAGEIDPVVGR
DAEIRQILDILLRRRQNNPLLVGEAGVGKTAVAEGFALRIAAGDVPPSLRDVALYLLDIGLLQAGASVKG
EFESRLRGVIDEAMSSERPAILFVDEVHTLVGAGGAAGTGDAANLLKPALARGLLRTIGATTWSEYKQYI
EKDPALTRRFQLVHVLEPDEAAAVTMLRGLAAKLEAHHRVLVLDDALHAAVTLSHRYIPARQLPDKAISL
LDTACSRVAVSQHAVPAPIEDARRRIDGLRVERERIGRECALGSGDSTRRDAIDAEVAATQAELDRLDTR
WQTERDALTSIVESRAALLDDEPTHERSAGARADLQARLAAAHQALADLQGDAPLVLPAVDTHAVAAVVA
DWTGIPLGRMVRDETQAVLKLAETLGERVVGQRHAVELVAERIQTARAKLDDPTKPHGVFLLCGPSGVGK
TETALALADTLYGGERNAITINMSEFQEAHTVSTLKGAPPGYVGYGQGGVLTEAVRRRPYSVVLLDEIEK
AHRDVHEIFLQVFDKGWMEDGEGRDIDFRHTVILLTSNVGADCVMQLCRDPERLPDVQTLADALRAPLLE
VFPAALLGRLTVVPYYPLTDATLARIVELQLRRFEKRIDLHHGIRLRCTDAATALIVERCRTIESGGRMV
DAILTHTVMPRIGRAILEATLEGRALAAIEVSAAGGEFAYRFDEESTT
 
Nucleotide Sequence: 2667 bp     [Download]
>gi|402567932|ref|NC_018514.1|:c1128034-1125368 Burkholderia cepacia GG4 chromosome 2, complete sequence
ATGTCCGATATCGGCCGCGTCAACCTGTTCGGAAAACTGAATCCGCTCCTCTACGAGACACTCGAGCAGG
CGACCGGATTCTGCCGGCTGCGCGGTAATCCGTACGTCGAACTCGCGCACTGGTTCAAGCAGATCCTGCA
GCGGCCCGATGGCGACCTGCAGCGCGTGCTGCACCGTTTCGGGATCGACGAGGCCGCCATCGAGCGCGGG
CTCGTCGCCGCGCTCGACCGGCTGCCGCGCGGCGCGGGATCGGTGTCGGACCTGTCCGCGCACATCGATG
ACGCGGTCGAGCGCGCGTGGGTCTATGCCACCTTGAAATACGACGCGACACGGATTCGCGGCGCGGTCCT
GCTGCTCGCGATCCTGAAGACGCCGCAACTGCGCAACGTGCTGTATGCGATCGCGCGCGAGTTCGAGCAC
ATCGTGCCCGACGTGCTGGCCGACGAACTCGAAGCGATCGTCGACGGGTCAGCCGAGGCGCAACCGGCCG
CGAACGCTGATGCGGGCGCCGGCTCAGGCGACGCCGCGATGCGCGGTGCGGCGGCCGTGAAAGGCTCGGC
TCTGGCGCGCTTTGCCGTCGACCTGACCGCCCGCGCGCGGGCTGGCGAAATCGATCCCGTCGTCGGGCGC
GACGCCGAGATTCGCCAGATCCTCGACATCCTGCTGCGGCGCCGGCAGAACAACCCGCTGCTGGTCGGTG
AGGCCGGCGTCGGCAAGACAGCCGTCGCGGAAGGCTTCGCGTTGCGGATCGCCGCCGGCGACGTGCCGCC
GTCGCTGCGCGACGTCGCGCTGTACCTGCTCGACATCGGGCTGCTGCAGGCCGGCGCGAGCGTGAAGGGC
GAGTTCGAGAGCCGGCTGCGCGGCGTGATCGACGAAGCGATGTCGTCCGAGCGGCCGGCGATCCTGTTCG
TCGACGAAGTGCATACGCTCGTCGGCGCGGGCGGGGCGGCCGGCACCGGCGACGCCGCGAACCTGCTGAA
ACCCGCGCTCGCGCGCGGCCTGCTGCGCACGATCGGCGCGACCACCTGGTCTGAGTACAAGCAGTACATC
GAAAAGGACCCCGCGCTGACCCGGCGCTTCCAGCTCGTGCACGTGCTCGAGCCCGACGAGGCCGCCGCGG
TGACGATGCTGCGCGGCCTGGCCGCGAAGCTCGAGGCCCACCACCGCGTGCTGGTGCTCGACGACGCGCT
GCATGCCGCGGTGACGCTGTCGCACCGGTATATCCCCGCGAGGCAGCTGCCGGACAAGGCGATCAGCCTG
CTCGACACCGCCTGCTCGCGCGTCGCCGTCAGCCAGCACGCGGTGCCTGCGCCGATCGAGGACGCGCGCC
GACGCATCGACGGCCTGCGGGTCGAGCGCGAACGGATCGGGCGCGAGTGTGCGCTCGGCAGCGGCGACAG
CACGCGGCGCGACGCGATCGATGCCGAGGTTGCCGCCACGCAGGCGGAACTCGACCGGCTCGACACGCGC
TGGCAGACCGAGCGCGACGCGTTGACCTCGATCGTCGAATCGCGCGCCGCGCTGCTCGACGACGAACCGA
CGCACGAACGCTCCGCCGGCGCGCGCGCCGACCTGCAGGCGCGCCTGGCCGCCGCGCATCAGGCACTGGC
CGACCTGCAGGGCGACGCACCGCTCGTGCTGCCCGCCGTCGACACGCATGCGGTCGCGGCCGTCGTCGCC
GACTGGACCGGCATCCCGCTCGGCCGGATGGTGCGCGACGAAACGCAGGCCGTGCTGAAGCTCGCAGAGA
CGCTCGGCGAACGCGTCGTCGGCCAGCGACATGCGGTCGAGCTAGTCGCCGAACGCATCCAGACCGCGCG
CGCGAAGCTCGACGACCCGACCAAGCCGCACGGCGTGTTCCTGCTGTGCGGGCCGTCCGGCGTCGGCAAG
ACCGAGACCGCGCTGGCGCTGGCCGACACGCTGTACGGCGGCGAGCGCAACGCGATCACGATCAACATGA
GCGAGTTCCAGGAGGCGCACACGGTATCGACGCTGAAGGGTGCGCCGCCCGGCTATGTCGGCTACGGACA
GGGCGGGGTGCTCACCGAGGCCGTGCGGCGTCGGCCGTACAGCGTCGTGCTGCTCGACGAGATCGAGAAG
GCGCACCGCGACGTGCACGAGATTTTCTTACAGGTGTTCGACAAGGGCTGGATGGAAGATGGCGAAGGGC
GCGACATCGACTTCCGGCATACCGTGATCCTGCTGACCTCGAACGTCGGCGCCGATTGCGTGATGCAGCT
GTGCCGCGACCCCGAGCGTCTGCCTGACGTGCAGACGCTCGCCGATGCGCTGCGCGCGCCGCTGCTCGAG
GTGTTCCCGGCCGCGCTGCTCGGCCGGCTGACTGTCGTGCCGTACTACCCGCTGACCGATGCGACGCTCG
CGCGCATCGTCGAACTGCAGTTGCGGCGCTTCGAGAAACGGATCGACCTGCATCACGGTATCCGGCTGCG
CTGCACCGACGCGGCGACCGCGCTGATCGTCGAGCGCTGCCGGACGATCGAATCCGGCGGCCGCATGGTC
GACGCAATCCTCACGCATACCGTGATGCCGCGGATCGGCCGCGCGATCCTCGAGGCCACGCTCGAAGGTC
GCGCACTGGCGGCAATCGAGGTGAGTGCGGCCGGCGGCGAATTCGCTTACCGGTTCGACGAGGAGAGCAC
GACGTGA
 Primer design