SecReT6
Protein ID: 402568945
SecReT6 ID689
T6SS typei3
Gene symbol-
Locus tagGEM_4205
StrainBurkholderia cepacia GG4
Repliconchromosome II [GenBank: NC_018514] [Browse all T6SS(s) in this replicon]
Location [Strand]1128047..1129156 [-]
Producthypothetical protein
NoteTssG
UniProt IDJ7J9F5
KEGG IDbct:GEM_4205
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.40E-120, Aligned region: 26..336
Protein Sequence: 369 a.a.     [Download]
>gi|402568945|ref|YP_006618289.1| hypothetical protein GEM_4205 [Burkholderia cepacia GG4]
MTHGTPSGAQPATETARRDAWWARLRAAPHGYDLFQALRWLDALSPGRAPLGHAARPRDEPVRLGQQPSL
AFAASMLARVSDDDGGAARPRIAIHGFGLFGPNGPLPTHLTEYAHERAAQHDDPTFAAFADLFHHRLILL
FYRAWADAQPTVSLDRPERARFDGYVASLIGRAAHGDKPAAQAGADTLAPHARYFHAGHLVRHTRNPEGL
VQILRRHFGVEARIVEHVPQWVAIERSQRCTIRATRPTLRVGAVALGVAVRDAQSHFRIVLGPLSLDAYR
RFLPGGPHARQLAQWVREYVGIEFDWDVRLELAADAVPAIALGAPQGLGRTAWLGQRLEAGPARDLVVRY
DARRGGPPGSGAALHRKTA
 
Nucleotide Sequence: 1110 bp     [Download]
>gi|402567932|ref|NC_018514.1|:c1129156-1128047 Burkholderia cepacia GG4 chromosome 2, complete sequence
ATGACGCACGGTACGCCGTCCGGCGCTCAGCCGGCTACCGAAACCGCACGCCGCGATGCGTGGTGGGCGC
GGCTGCGTGCCGCACCGCACGGCTACGACCTGTTTCAGGCTTTGCGCTGGCTCGACGCGCTGTCACCGGG
CCGCGCACCGCTCGGCCATGCCGCGCGTCCGCGCGACGAACCCGTGCGGCTCGGGCAGCAGCCGTCGCTC
GCGTTCGCGGCGTCGATGCTGGCCCGTGTATCCGACGATGACGGTGGCGCTGCGCGGCCGCGCATCGCGA
TCCACGGTTTCGGGTTGTTCGGGCCGAACGGGCCGCTGCCGACTCACTTGACCGAATACGCACACGAGCG
CGCGGCGCAGCACGACGACCCGACCTTCGCCGCGTTCGCGGACCTGTTCCACCACCGGCTGATCCTGCTG
TTCTACCGTGCATGGGCCGACGCACAGCCGACCGTGAGCCTCGATCGCCCGGAACGCGCGCGGTTCGACG
GCTATGTCGCGAGCCTGATCGGTCGGGCGGCACACGGCGACAAGCCCGCCGCGCAAGCCGGCGCCGACAC
GCTCGCGCCGCATGCGCGCTATTTCCACGCGGGCCATCTCGTGCGGCATACGCGCAACCCGGAAGGGCTC
GTGCAGATCCTGCGCCGGCATTTCGGTGTCGAGGCCCGCATCGTCGAGCACGTGCCGCAGTGGGTCGCGA
TCGAACGGTCGCAGCGCTGCACGATCCGCGCGACGCGGCCGACCTTGCGCGTCGGCGCCGTCGCGCTCGG
CGTCGCGGTGCGCGATGCGCAGTCGCACTTCCGGATCGTGCTCGGCCCGCTATCGCTCGACGCGTACCGC
CGCTTCCTGCCGGGCGGTCCGCATGCCCGGCAGCTTGCGCAATGGGTGCGCGAATACGTCGGCATCGAGT
TCGACTGGGACGTACGGCTTGAACTGGCGGCCGACGCGGTGCCGGCGATCGCGCTTGGCGCGCCGCAGGG
CCTCGGCCGCACCGCGTGGCTCGGGCAGCGGCTCGAAGCGGGGCCCGCACGCGATCTCGTCGTCCGTTAC
GACGCGCGCCGTGGCGGTCCGCCGGGTAGCGGCGCCGCCCTTCATCGCAAAACCGCCTAA
 Primer design