SecReT6
Protein ID: 402568946
SecReT6 ID689
T6SS typei3
Gene symbol-
Locus tagGEM_4206
StrainBurkholderia cepacia GG4
Repliconchromosome II [GenBank: NC_018514] [Browse all T6SS(s) in this replicon]
Location [Strand]1129153..1131024 [-]
Producthypothetical protein
NoteTssF
UniProt IDJ7JHS8
KEGG IDbct:GEM_4206
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.80E-213, Aligned region: 5..622
Protein Sequence: 623 a.a.     [Download]
>gi|402568946|ref|YP_006618290.1| hypothetical protein GEM_4206 [Burkholderia cepacia GG4]
MDTRLLDYYNRELAYLRELGGEFAQQFPKVAARLRLHESGPPDPYVERLLEGFSFLTARVQLKMDAEFPR
FTQALLDAVYPGYLAPLPSMAIVRFAPMLNEGSLAQGWRLPAGTALRARPAASEQTACEFRTAHDLTLWP
LELTEATVTGAPSWLPRGVVPARQDVRGALRIRLKARGGAKLSQLPLERLTFHLAGPERDALHLLELIAA
HALGVVCHDPGQAPRWLHTLDADAIVHEGFDPAQAILPDEGRSFHGYRLLREYFAFPARFLFFSISGLRA
ALTRATGDECELTVLFDRADAALEAAVDARHLALNCTPAVNLFARRGDRIPLQPGAREHHVVVDRSRPLD
HEVYAVQRLASVQRDDGQSREFRPFHASFARDDGNYGAYYTVRREPRLVSAQARANGTRTGYVGSETYVS
LVDSQCAPYDETMRYLSVDTLCTNRDLVLLQPPGDANTFTLRISAPVERIVAIRGPSRPRPPIADTQSAW
RLIRHLGLARQTMTDLDDDEGAHALRELLGLHADPADAAMRRQIDGVRRVAFSPVFRRLPALGPLMFGRG
VQVDVTVDDHAFSGDSPFLLGAVLEQFFARHVSINAFAECVLTSTQRGTLAHWPARIGRRPAI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|402567932|ref|NC_018514.1|:c1131024-1129153 Burkholderia cepacia GG4 chromosome 2, complete sequence
ATGGATACGCGCCTGCTCGACTACTACAACCGCGAACTCGCGTATCTGCGCGAGCTCGGCGGCGAATTCG
CGCAGCAGTTCCCGAAGGTCGCCGCGCGGCTGCGGCTGCACGAATCGGGGCCACCCGATCCGTACGTCGA
ACGGCTGCTCGAAGGCTTCAGCTTCCTCACCGCGCGCGTGCAGCTGAAGATGGATGCCGAGTTTCCGCGC
TTCACGCAGGCGCTGCTCGATGCCGTGTATCCGGGCTATCTCGCGCCGTTGCCGTCGATGGCGATCGTGC
GGTTCGCGCCGATGCTGAACGAGGGCAGCCTCGCACAGGGCTGGCGGCTGCCGGCTGGCACCGCGTTGCG
CGCGCGGCCGGCCGCGTCCGAGCAGACCGCGTGCGAATTCCGCACCGCGCACGACCTGACGCTGTGGCCG
CTCGAACTGACCGAGGCGACCGTCACCGGTGCGCCGTCGTGGCTGCCGCGCGGGGTCGTGCCGGCGCGCC
AGGACGTGCGCGGGGCGCTGCGCATCCGGCTGAAGGCACGCGGCGGTGCCAAACTCTCGCAACTGCCGCT
CGAGCGCCTGACCTTTCATCTCGCGGGCCCCGAGCGCGACGCGCTGCACCTGCTCGAACTGATCGCCGCG
CATGCGCTCGGCGTCGTGTGCCACGATCCGGGGCAGGCGCCGCGCTGGCTGCACACGCTCGACGCCGACG
CAATCGTCCACGAGGGTTTCGATCCGGCGCAGGCGATCCTGCCCGATGAGGGGCGCAGCTTCCACGGCTA
CCGGCTACTGCGCGAGTATTTCGCGTTTCCGGCACGCTTCCTGTTCTTCAGCATCAGCGGGCTGCGCGCC
GCGCTCACGCGCGCCACCGGCGACGAGTGCGAGCTGACCGTGCTGTTCGACCGCGCCGACGCGGCGCTCG
AAGCGGCCGTCGATGCGCGGCATCTGGCACTGAACTGCACGCCGGCCGTGAACCTGTTCGCCCGCCGCGG
CGACCGCATTCCGTTGCAGCCGGGCGCGCGCGAGCATCATGTCGTCGTCGACCGCAGCCGGCCGCTCGAC
CATGAGGTCTATGCCGTGCAGCGGCTCGCGAGCGTGCAGCGCGACGACGGCCAGTCGCGCGAATTCCGGC
CGTTTCACGCATCGTTCGCGCGCGACGACGGCAACTATGGTGCGTACTACACGGTGCGGCGCGAGCCCCG
GCTGGTGTCCGCACAGGCACGCGCGAACGGCACGCGCACTGGCTACGTCGGCAGCGAAACCTACGTGTCG
CTGGTCGACAGCCAGTGCGCGCCGTACGACGAGACGATGCGCTACCTGTCCGTCGACACGCTGTGTACCA
ACCGCGATCTCGTGCTGCTGCAGCCGCCGGGCGACGCGAACACATTCACGCTGCGCATCTCGGCGCCCGT
CGAGCGCATCGTCGCGATTCGTGGCCCGTCGCGGCCGCGTCCGCCGATCGCCGATACGCAGTCGGCCTGG
CGGCTGATCCGCCATCTCGGGCTGGCCCGCCAGACGATGACCGATCTCGACGACGACGAAGGCGCGCATG
CGCTGCGCGAACTGCTCGGCCTGCATGCCGATCCGGCCGATGCTGCGATGCGCCGGCAGATCGACGGCGT
GCGGCGCGTCGCATTCTCGCCCGTGTTCCGGCGGCTGCCGGCGCTCGGGCCGCTGATGTTCGGACGCGGC
GTGCAGGTCGACGTGACCGTGGACGACCATGCGTTCTCCGGCGACAGCCCGTTCCTGCTCGGCGCGGTGC
TCGAACAGTTCTTCGCGCGTCACGTCTCGATCAACGCGTTCGCCGAATGCGTGCTGACCAGCACGCAGCG
CGGCACGCTCGCGCACTGGCCGGCGCGTATCGGCAGGCGGCCCGCGATATGA
 Primer design