SecReT6
Protein ID: 402568947
SecReT6 ID689
T6SS typei3
Gene symbol-
Locus tagGEM_4207
StrainBurkholderia cepacia GG4
Repliconchromosome II [GenBank: NC_018514] [Browse all T6SS(s) in this replicon]
Location [Strand]1131029..1131577 [-]
Producthypothetical protein
NoteTssE
UniProt IDJ7J8L3
KEGG IDbct:GEM_4207
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.60E-22, Aligned region: 45..160
Protein Sequence: 182 a.a.     [Download]
>gi|402568947|ref|YP_006618291.1| hypothetical protein GEM_4207 [Burkholderia cepacia GG4]
MDDPDTRDGRHGGMRDRLQPALLDRLTDDAPRRTTDLPGAQWIGAERLRAAVLRDLAWLLNTRNAEDGFV
DWAAFAHAQASVLNYGMRPLVGKPMSGVERMSVEASIRDAIVRFEPRIAPDSVEVRSIADAPGGRAGERR
HNVLLFEIRGTLWSIPHPVEFVLRSDLDLETGAMSLQSRAGS
 
Nucleotide Sequence: 549 bp     [Download]
>gi|402567932|ref|NC_018514.1|:c1131577-1131029 Burkholderia cepacia GG4 chromosome 2, complete sequence
ATGGACGACCCGGACACCCGCGATGGCCGGCATGGCGGCATGCGCGACCGGCTGCAGCCCGCGCTGCTCG
ACCGGCTGACCGACGACGCGCCGCGGCGCACGACCGACCTGCCCGGCGCGCAATGGATCGGCGCCGAGCG
CCTGCGTGCAGCCGTGCTGCGCGATCTCGCGTGGCTGCTCAACACGCGCAACGCCGAGGACGGCTTCGTC
GACTGGGCGGCGTTCGCGCATGCGCAGGCGTCGGTGCTCAACTACGGGATGCGGCCGCTCGTCGGCAAGC
CGATGTCGGGCGTCGAACGAATGTCGGTCGAGGCGTCGATTCGCGACGCGATCGTTCGCTTCGAGCCGCG
CATCGCGCCCGACAGCGTCGAGGTGCGCAGCATCGCCGATGCGCCGGGCGGTCGCGCCGGCGAACGGCGT
CACAACGTGCTGCTGTTCGAGATCCGCGGCACGCTGTGGTCGATCCCGCATCCGGTCGAATTCGTGCTGC
GCTCCGATCTCGACCTGGAGACGGGCGCGATGTCGCTGCAGTCGAGGGCGGGGAGCTGA
 Primer design