SecReT6
Protein ID: 402568948
SecReT6 ID689
T6SS typei3
Gene symbol-
Locus tagGEM_4208
StrainBurkholderia cepacia GG4
Repliconchromosome II [GenBank: NC_018514] [Browse all T6SS(s) in this replicon]
Location [Strand]1131594..1132085 [-]
Producthypothetical protein
NoteTssD
UniProt IDJ7JGW4
KEGG IDbct:GEM_4208
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-33, Aligned region: 6..138
Protein Sequence: 163 a.a.     [Download]
>gi|402568948|ref|YP_006618292.1| hypothetical protein GEM_4208 [Burkholderia cepacia GG4]
MGVAMFMKVDGVTGESADAQHKGWTDIESFTWGASQPGAMASGSGGNAGKASFNDLVVAAYMDKGAPAIV
KNCASGKHLPKVEISACKTGGSQVEFMRVTLQEVLVTSAQVAGIDPGDAADRLMMHYGFQAAKVKKQYWQ
QNDNGGKGAEVSVGWNIKENTEM
 
Nucleotide Sequence: 492 bp     [Download]
>gi|402567932|ref|NC_018514.1|:c1132085-1131594 Burkholderia cepacia GG4 chromosome 2, complete sequence
ATGGGCGTGGCAATGTTTATGAAGGTGGACGGCGTGACCGGCGAATCGGCGGACGCGCAGCACAAGGGCT
GGACCGACATCGAATCGTTCACGTGGGGCGCGAGCCAGCCGGGCGCGATGGCGAGCGGCAGCGGCGGCAA
CGCGGGCAAGGCGAGCTTCAACGATCTCGTCGTGGCCGCGTACATGGACAAGGGGGCGCCCGCGATCGTC
AAGAACTGCGCGAGCGGCAAGCACTTGCCGAAGGTCGAGATCTCCGCGTGCAAGACCGGCGGCTCGCAGG
TCGAGTTCATGCGGGTCACGCTGCAGGAAGTGCTCGTCACGTCCGCGCAGGTCGCGGGCATCGATCCCGG
CGACGCGGCCGACCGGCTGATGATGCACTACGGCTTCCAGGCCGCGAAGGTGAAGAAGCAATACTGGCAG
CAGAACGACAACGGCGGCAAGGGCGCCGAGGTGTCGGTCGGCTGGAACATCAAGGAAAACACCGAGATGT
GA
 Primer design