SecReT6
Protein ID: 402568949
SecReT6 ID689
T6SS typei3
Gene symbol-
Locus tagGEM_4209
StrainBurkholderia cepacia GG4
Repliconchromosome II [GenBank: NC_018514] [Browse all T6SS(s) in this replicon]
Location [Strand]1132157..1133665 [-]
Producthypothetical protein
NoteTssC
UniProt IDJ7JE06
KEGG IDbct:GEM_4209
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.40E-194, Aligned region: 69..495
Protein Sequence: 502 a.a.     [Download]
>gi|402568949|ref|YP_006618293.1| hypothetical protein GEM_4209 [Burkholderia cepacia GG4]
MNDPAQSRADARDAALPAAAHGEFAALLQKEFKPKTAEARESVERAVRTLAQQALEHTVGMTTDAYGSVK
QIIAEIDRKLSEQINQILHHDDFQTLEGAWRGLHYLVTHTETDELLKIKALPASRHEVARMLKRYKGVAW
DQSPLFRKIYEEEYGQFGGEPFGCLVGDFYFNHSPPDVEMLGELSKIAAAAHAPFIAGASPELMQMDSWQ
ELSNPRDLTKIFQNTEYAAWRSLRQSEDSRYVGLAMPRFLARLPYGARTNPVDEFDFEEDTDAANHDRYT
WANSAYAMAANINRSFKQYGWCSSIRGVESGGAVEGLPSHTFPTDDGGVDQKCPTEIAISDRREAELAKN
GFMPFVHRKNSDFAAFIGAQSLYQPAEYHDPDATANARLSGRLPYLFACCRFAHYLKCIVRDKIGSFRER
DDMERWLNDWIMNYVDGDPVNSSQETKARKPLAAAQVVVDEVEDNPGYYTSKFFLRPHYQLEGLTVSLRL
ISRLPSAKAANE
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|402567932|ref|NC_018514.1|:c1133665-1132157 Burkholderia cepacia GG4 chromosome 2, complete sequence
ATGAATGACCCCGCCCAGTCCCGCGCCGACGCACGCGACGCCGCGCTGCCGGCCGCCGCGCACGGCGAGT
TCGCCGCGCTGCTGCAGAAGGAGTTCAAGCCGAAGACCGCCGAGGCGCGCGAGTCGGTCGAGCGCGCGGT
GCGCACGCTCGCGCAGCAGGCGCTCGAACATACGGTCGGCATGACGACCGACGCATACGGCAGCGTGAAG
CAGATCATCGCGGAGATCGACCGCAAGCTGTCCGAGCAGATCAACCAGATCCTGCATCACGACGACTTCC
AGACGCTCGAAGGCGCATGGCGCGGCCTGCATTACCTTGTCACGCACACCGAGACCGACGAGCTGCTGAA
GATCAAGGCGTTGCCGGCGTCGCGCCACGAGGTCGCGCGGATGCTCAAGCGCTACAAGGGCGTCGCGTGG
GATCAGAGCCCGCTGTTCCGCAAGATCTACGAGGAGGAGTACGGGCAGTTCGGCGGCGAGCCGTTCGGCT
GCCTCGTCGGCGACTTCTACTTCAATCACAGCCCGCCGGACGTCGAGATGCTCGGCGAGCTGTCGAAGAT
CGCGGCGGCTGCGCACGCGCCGTTCATTGCGGGCGCGTCGCCGGAGCTGATGCAGATGGATTCGTGGCAG
GAGCTGTCGAATCCGCGCGACCTCACGAAGATCTTCCAGAACACCGAATACGCGGCGTGGCGCAGCCTGC
GGCAGTCGGAGGATTCGCGCTACGTCGGCCTCGCGATGCCGCGTTTTCTCGCGCGGCTGCCGTACGGCGC
GCGCACCAATCCGGTCGACGAATTCGACTTCGAGGAAGACACCGACGCCGCGAATCACGACCGCTACACG
TGGGCGAATTCCGCTTACGCGATGGCCGCCAACATCAACCGCTCGTTCAAGCAGTACGGCTGGTGCTCGT
CGATCCGCGGCGTCGAGTCGGGCGGAGCGGTCGAAGGGCTGCCGAGTCACACGTTCCCGACCGACGACGG
CGGCGTCGACCAGAAATGCCCGACCGAGATCGCGATCAGCGACCGCCGCGAGGCCGAGCTCGCGAAAAAC
GGCTTCATGCCGTTCGTGCACCGGAAGAACTCGGACTTCGCGGCGTTCATCGGTGCGCAGTCGCTGTACC
AGCCGGCCGAGTATCACGACCCCGACGCGACCGCGAACGCGCGGCTGTCCGGCCGCCTGCCTTACCTGTT
CGCGTGCTGTCGGTTCGCGCACTACCTGAAATGCATCGTGCGCGACAAGATCGGCTCGTTCCGCGAGCGC
GACGACATGGAGCGCTGGCTGAACGACTGGATCATGAACTACGTCGACGGTGACCCCGTGAACTCGTCGC
AGGAAACCAAGGCGCGCAAGCCGCTGGCGGCTGCCCAGGTGGTGGTCGACGAGGTCGAGGACAACCCCGG
CTACTACACGTCGAAATTCTTCCTGAGGCCGCACTACCAGCTCGAAGGGCTCACCGTATCGCTGCGGCTC
ATCTCGCGGCTGCCGTCCGCGAAGGCGGCGAACGAGTGA
 Primer design