SecReT6
Protein ID: 402568950
SecReT6 ID689
T6SS typei3
Gene symbol-
Locus tagGEM_4210
StrainBurkholderia cepacia GG4
Repliconchromosome II [GenBank: NC_018514] [Browse all T6SS(s) in this replicon]
Location [Strand]1133658..1134197 [-]
Producthypothetical protein
NoteTssB
UniProt IDJ7J9G0
KEGG IDbct:GEM_4210
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.90E-58, Aligned region: 15..168
Protein Sequence: 179 a.a.     [Download]
>gi|402568950|ref|YP_006618294.1| hypothetical protein GEM_4210 [Burkholderia cepacia GG4]
MTDRTKAAGSGQKFIARNRAPRVQIEYDVETYGAERKVQLPFVMGVIADLAGKRAEPLPDLPERKFLEID
VDNFDERMKSVAPRVAFQVPNTLTGEGMLSVDVTFEQIDDFSPAAIARNVDALRRLLDARTELSNLLSYM
DGKHGAEQLIERAINDPDLLKMLVREPRADATEPEARDE
 
Nucleotide Sequence: 540 bp     [Download]
>gi|402567932|ref|NC_018514.1|:c1134197-1133658 Burkholderia cepacia GG4 chromosome 2, complete sequence
ATGACGGACAGAACCAAGGCGGCGGGCAGCGGACAGAAGTTCATCGCGCGCAATCGGGCGCCGCGCGTGC
AGATCGAGTACGACGTCGAGACCTACGGCGCCGAGCGCAAGGTGCAGCTGCCGTTCGTGATGGGCGTCAT
CGCGGACCTAGCGGGCAAGCGCGCCGAGCCGCTGCCGGATTTGCCCGAGCGCAAGTTCCTCGAGATCGAC
GTCGACAACTTCGACGAGCGGATGAAATCGGTCGCGCCGCGCGTCGCATTCCAGGTGCCGAACACGCTGA
CGGGCGAAGGGATGCTCAGCGTCGACGTGACGTTCGAGCAGATCGACGATTTCTCGCCGGCGGCGATCGC
GCGCAACGTCGACGCGCTGCGCCGGCTGCTGGACGCGCGCACTGAGCTGTCGAACCTGCTGTCCTACATG
GACGGCAAGCATGGCGCCGAACAGCTGATCGAGCGCGCGATCAACGATCCCGACCTGCTGAAGATGCTGG
TGCGCGAACCGCGCGCCGATGCGACCGAACCGGAGGCCCGCGATGAATGA
 Primer design