SecReT6
Protein ID: 402568951
SecReT6 ID689
T6SS typei3
Gene symbol-
Locus tagGEM_4211
StrainBurkholderia cepacia GG4
Repliconchromosome II [GenBank: NC_018514] [Browse all T6SS(s) in this replicon]
Location [Strand]1134258..1135388 [-]
ProductImpA-like protein
NoteTssA
UniProt IDJ7JHT3
KEGG IDbct:GEM_4211
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-22, Aligned region: 82..142
Protein Sequence: 376 a.a.     [Download]
>gi|402568951|ref|YP_006618295.1| ImpA-like protein [Burkholderia cepacia GG4]
MHSNDVSQAALAAAALSSPSPGLPVASPRADLIGRLLADVAPGTPCGANLEYDADFLQLQERATPRAEQQ
YGDTVIPAETPDWRAVERLALALTERTKDLRVVAYLARSWTEQHGIPGYADALAVVAGLLERGWDDLHPR
LDADGEPDPTRRMNALADVAGAHECARAARRQPLFDGGPSVRDAERALDGRDEAGGPAAGSRDGLVAALS
SARDDGRVPIEAVRAALHALDAIRAHVTDRLGSEWAPDASDTEKALQRIVCEVPVPEPAPAAQPAPPDGS
IPATPAASGAAQAVPAPAVVPNGHAWRDAEVTSRDDVRLGLDKMCRYFELHEPSHPAPLLLRRAQRLLAL
DFYEIIRDLAPESLAKLDLLSGERSE
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|402567932|ref|NC_018514.1|:c1135388-1134258 Burkholderia cepacia GG4 chromosome 2, complete sequence
ATGCATTCGAATGACGTCAGCCAGGCGGCGCTGGCCGCCGCCGCGTTGTCCTCGCCGTCACCCGGCCTGC
CGGTGGCGTCGCCGCGCGCCGACCTGATCGGCCGGCTGCTCGCGGACGTCGCGCCCGGCACGCCGTGCGG
CGCGAACCTCGAATACGACGCCGACTTCCTGCAGCTTCAGGAGCGGGCGACGCCGCGCGCCGAGCAGCAG
TACGGCGACACCGTGATCCCGGCCGAAACACCCGACTGGCGCGCGGTCGAGCGCCTCGCGCTCGCGCTGA
CCGAGCGTACGAAGGACCTGCGCGTCGTCGCGTATCTCGCGCGCAGCTGGACCGAACAGCACGGCATTCC
CGGCTACGCGGACGCGCTCGCGGTCGTCGCGGGCCTGCTCGAGCGCGGCTGGGACGACCTTCATCCTCGC
CTCGACGCCGACGGCGAGCCGGACCCGACACGGCGGATGAACGCGCTCGCCGATGTCGCCGGTGCGCACG
AGTGTGCGCGTGCGGCACGGCGCCAGCCGCTGTTCGATGGCGGCCCGAGCGTGCGCGATGCCGAACGCGC
GCTCGACGGCCGCGACGAAGCGGGTGGCCCGGCAGCAGGCAGCCGCGACGGCCTGGTCGCGGCACTGTCG
AGTGCGCGTGACGACGGCCGCGTGCCGATCGAGGCGGTGCGCGCCGCGCTGCACGCGCTGGACGCGATCC
GTGCGCACGTGACGGACCGGCTCGGCAGCGAATGGGCGCCCGATGCGAGCGACACGGAGAAAGCGTTGCA
ACGCATCGTGTGCGAAGTGCCGGTTCCGGAGCCCGCACCGGCGGCGCAGCCGGCCCCACCGGACGGTTCG
ATTCCGGCAACGCCGGCTGCGTCCGGCGCCGCGCAAGCCGTCCCTGCGCCGGCCGTTGTGCCGAACGGGC
ACGCATGGCGCGATGCTGAGGTCACGAGCCGCGACGACGTGCGGCTCGGCCTCGACAAGATGTGCCGGTA
TTTCGAACTACACGAGCCGAGTCATCCGGCGCCGCTGCTGTTGCGGCGCGCGCAGCGGCTGCTCGCGCTC
GACTTCTACGAAATCATCCGGGATCTCGCCCCGGAGAGCCTGGCGAAGCTGGACCTGCTGAGCGGCGAGC
GAAGCGAATGA
 Primer design