SecReT6
Protein ID: 402568954
SecReT6 ID689
T6SS typei3
Gene symbol-
Locus tagGEM_4214
StrainBurkholderia cepacia GG4
Repliconchromosome II [GenBank: NC_018514] [Browse all T6SS(s) in this replicon]
Location [Strand]1138479..1142108 [-]
Producthypothetical protein
NoteTssM
UniProt IDJ7JE11
KEGG IDbct:GEM_4214
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.40E-94, Aligned region: 214..478
ImcF-related_N [PF14331], Evalue: 7.40E-94, Aligned region: 1062..1082
IcmF-related [PF06761], Evalue: 6.20E-92, Aligned region: 526..837
DUF1215 [PF06744], Evalue: 1.20E-34, Aligned region: 64..87
DUF1215 [PF06744], Evalue: 1.20E-34, Aligned region: 945..1069
Protein Sequence: 1209 a.a.     [Download]
>gi|402568954|ref|YP_006618298.1| hypothetical protein GEM_4214 [Burkholderia cepacia GG4]
MNQAVARLVRPLPSREIWTFAGLVLLACFVWLAGPLFAFAEVRPLESGWARGGTIAVLFVAWGARVAWRS
WHASRLNAQLLNQLRAAAPGPATADDPAKAQLDELRSRFDEAATLLKKVRFGQAETARSGLAHWFDRMSR
QYLYQLPWYVFIGAPGSGKTTALVNSGLSFPLAEQFGRAAIRGVGGTRHCDWWFTNDAVLIDTAGRYTTH
EGNRALDEAEWKGFVELLKKYRTRQPLNGAMLTISVADLVGASEAERTQHAMVLRKRLLELRAQLGIRFP
VYLLVTKADLLAGFAEYFGAFGRAECAQVWGFTFPLAQCEAPGFDLRAAFDREYRLLHQRLNDGLPELLA
AQTDARQREMAYLLPQQVADLQDLLGQFVAEVFSVSSFEPMPMLRGVYLTSGTQEGTAFDRVMSGIKRFL
KIEGVPPVAQVGSSGRSFFLKSLLQEHIFREAALAGSDLRWHQKRRVLQITGYVLLAVVSVAVLAAWLRS
YSNNRAYLDRIAQRVPAVDTQIAGAKFSDAADIARLLPVLDALGGLANAGGVDRSHPPLAYRWGLFQGEK
IDEAVDAVYRRALDDVLLPLAARRMEAALRDARPDETEYAYAALKAYLMLYDSAHYDPAFVQAVVDLEME
RALPPDFSPAERSALRAHLAALFGNRVAVSPYPMNERLVADVRDRLRQVPFSQRLYRQLTHTLRPATSAF
DFGVARAVGPDASLVFRRQSGKPLSEGVPGLYTRNGYRNVFSPRLAGEVDAYGREEVWVLNLGLSEIPGP
NDAAAWARDIRQLYLNDYLKIWDDYLADLKLQRTATLAQSIQVARALSSADSPLTRLMVALARDTALGNA
PGGARHLASRAQDKVDEARSSLSQIFAGQGASDANPSAAVPASPEQVVDSHFAGLRAFAPGSGDQAQAFD
AVLKSIDALYTYLTATDDALRSGAQAPPSDAPARLRAQAGRLPTPFREVLDDLSNVANGSVATVEQRSVA
QRAGANVGDFCRQAIAGRYPFARGSARDVAPADFAQMFAPGGLMDDFFQKNLQSIVDTTSHPWRFANRNA
DADPAAAAMLASFEKAAVIRDVYFGGGARTAQLKVQIQTLEMDPSIPEMVLDVDGQVVRYAHGPLVQSAV
DWPGPRGSNQVRLQVAGPAGATDGFTTDGPWALHRLFDRAAVSAGRGSDRMLARFTVDGKPLVLQVNAGS
VRNPFRLPQMESFTCPPKQ
 
Nucleotide Sequence: 3630 bp     [Download]
>gi|402567932|ref|NC_018514.1|:c1142108-1138479 Burkholderia cepacia GG4 chromosome 2, complete sequence
ATGAACCAGGCTGTCGCGCGTTTGGTCCGGCCGTTGCCGTCGCGGGAGATCTGGACCTTCGCCGGTCTCG
TCCTGCTGGCGTGCTTCGTGTGGCTCGCCGGCCCGCTGTTCGCGTTCGCCGAGGTCCGGCCGCTCGAGAG
CGGCTGGGCGCGCGGCGGGACGATCGCGGTCCTGTTCGTCGCGTGGGGCGCGCGCGTGGCATGGCGAAGC
TGGCACGCGAGCCGCCTCAACGCGCAGTTGCTGAACCAGTTGCGCGCAGCCGCACCCGGGCCGGCCACCG
CCGACGATCCGGCGAAGGCGCAGCTCGACGAACTGCGCAGCCGCTTCGACGAGGCCGCGACGCTGCTGAA
GAAAGTCCGCTTCGGGCAAGCCGAGACCGCGCGCAGCGGCCTCGCGCACTGGTTCGACCGGATGTCGCGC
CAGTATCTGTACCAGCTCCCGTGGTATGTGTTCATCGGTGCGCCGGGTTCGGGCAAGACGACCGCGCTCG
TCAATTCCGGGCTCAGTTTTCCGCTCGCCGAGCAGTTCGGCCGCGCGGCGATTCGCGGCGTCGGCGGCAC
CCGGCACTGCGACTGGTGGTTCACGAACGACGCAGTGCTGATCGACACGGCCGGCCGCTATACGACCCAC
GAAGGTAACCGCGCGCTCGACGAAGCCGAGTGGAAGGGCTTCGTCGAATTGCTGAAGAAGTACCGGACGC
GCCAGCCGCTGAACGGCGCGATGCTGACGATCAGCGTTGCCGATCTGGTCGGTGCGTCGGAAGCCGAGCG
TACGCAGCATGCGATGGTGCTGCGCAAGCGGCTGCTCGAATTGCGCGCCCAGCTCGGCATCCGTTTTCCC
GTCTACCTGCTCGTGACGAAGGCCGACCTGCTGGCCGGCTTCGCCGAGTATTTCGGCGCTTTCGGCCGCG
CGGAATGCGCGCAGGTGTGGGGTTTCACGTTCCCGCTCGCGCAGTGCGAGGCGCCGGGCTTCGATCTGCG
TGCCGCGTTCGACCGCGAATACCGGCTGCTGCACCAGCGGCTGAACGACGGGCTTCCCGAACTGCTCGCC
GCGCAGACCGACGCGCGCCAGCGCGAGATGGCGTACCTGCTGCCGCAGCAGGTCGCCGACCTGCAGGACC
TGCTCGGCCAGTTCGTCGCCGAAGTGTTTTCCGTGTCGAGCTTCGAGCCGATGCCGATGCTGCGCGGCGT
GTACCTGACGAGCGGCACGCAGGAGGGCACCGCGTTCGACCGCGTGATGAGCGGCATCAAGCGCTTCCTG
AAGATCGAGGGCGTGCCGCCGGTCGCGCAGGTCGGCTCGAGCGGGCGCAGCTTCTTCCTGAAGTCGCTGC
TGCAGGAGCACATCTTCCGCGAGGCCGCGCTCGCCGGCAGCGACCTGCGCTGGCATCAGAAGCGGCGCGT
GCTGCAGATCACCGGCTATGTGCTGCTCGCGGTCGTGAGCGTGGCCGTGCTGGCCGCATGGCTGCGCAGC
TACTCGAACAATCGCGCGTATCTCGACCGGATCGCACAGCGCGTGCCCGCCGTCGATACGCAGATCGCCG
GCGCGAAATTCTCGGATGCGGCCGACATCGCACGGCTGCTGCCGGTGCTCGACGCGCTCGGCGGGCTCGC
GAATGCCGGCGGTGTCGACCGGTCGCATCCGCCGCTCGCGTACCGCTGGGGGCTGTTCCAGGGCGAGAAG
ATCGACGAGGCCGTCGACGCCGTGTACCGGCGCGCGCTCGACGACGTGCTGCTGCCGCTCGCCGCGCGCC
GGATGGAGGCCGCGCTGCGCGACGCGCGGCCCGACGAAACCGAATACGCGTATGCGGCGCTGAAGGCCTA
CCTGATGCTGTACGACAGCGCGCACTACGATCCGGCGTTCGTGCAGGCCGTCGTCGATCTGGAAATGGAG
CGCGCGTTGCCGCCCGATTTCTCGCCGGCCGAACGCTCGGCGCTGCGTGCGCATCTCGCCGCACTGTTCG
GCAACCGGGTGGCGGTGTCGCCGTATCCGATGAACGAGCGGCTCGTGGCCGACGTGCGCGACCGGCTGCG
CCAGGTGCCGTTCTCGCAGCGGCTGTATCGCCAGCTCACGCATACGCTGCGGCCGGCGACCTCGGCGTTC
GACTTCGGCGTCGCGCGCGCGGTGGGCCCGGATGCGTCGCTGGTATTCCGCCGCCAGAGTGGCAAGCCGT
TGTCGGAAGGCGTGCCGGGCCTCTACACGCGCAACGGCTATCGCAACGTGTTCTCGCCGCGCCTGGCCGG
CGAGGTCGACGCGTACGGGCGCGAGGAGGTGTGGGTGCTGAACCTCGGGCTGTCCGAGATTCCCGGGCCG
AACGACGCCGCCGCGTGGGCGCGCGACATCCGCCAGTTGTACCTGAACGACTACCTGAAGATCTGGGACG
ACTATCTCGCCGACCTCAAGCTGCAGCGCACGGCGACGCTCGCACAGAGCATCCAGGTTGCGCGTGCGCT
GTCTTCGGCGGATTCGCCGCTCACCCGGTTGATGGTTGCGCTCGCGCGCGACACGGCGCTCGGCAATGCG
CCGGGCGGCGCGCGCCATCTCGCGTCGCGCGCCCAGGACAAGGTCGACGAGGCGCGCAGTTCGTTGTCGC
AGATCTTCGCGGGGCAGGGCGCGAGCGACGCGAATCCGTCCGCGGCGGTACCCGCGAGCCCCGAGCAGGT
GGTCGACAGCCACTTCGCCGGGCTGCGCGCGTTCGCGCCGGGCAGCGGCGACCAGGCCCAGGCGTTCGAC
GCGGTGCTGAAGTCGATCGACGCGCTCTATACGTACCTGACGGCCACCGACGACGCGCTGCGCAGCGGCG
CGCAAGCGCCGCCGTCCGATGCGCCCGCGCGGCTGCGCGCGCAGGCCGGGCGGCTGCCCACGCCGTTCCG
CGAAGTGCTCGACGACCTGTCGAACGTCGCGAACGGCAGCGTCGCGACCGTCGAGCAACGCAGCGTCGCA
CAGCGGGCCGGCGCGAACGTCGGGGATTTCTGCCGGCAGGCGATCGCGGGCCGCTATCCGTTCGCGCGCG
GCTCGGCGCGTGACGTCGCACCGGCGGATTTTGCGCAGATGTTCGCGCCGGGCGGGCTGATGGACGATTT
CTTCCAGAAGAACCTGCAGTCGATCGTCGATACGACGTCGCACCCGTGGCGCTTCGCGAACCGCAATGCG
GATGCCGATCCGGCGGCGGCCGCGATGCTCGCGTCGTTCGAGAAGGCCGCCGTGATCCGCGACGTCTATT
TCGGCGGCGGTGCGCGCACGGCGCAGTTGAAGGTGCAGATCCAGACGCTCGAGATGGACCCGTCGATCCC
GGAGATGGTGCTCGACGTCGACGGCCAGGTCGTCCGCTATGCGCACGGCCCGCTCGTGCAGAGCGCGGTG
GACTGGCCGGGCCCGCGCGGCAGCAACCAGGTGCGGCTGCAGGTGGCGGGGCCGGCCGGCGCGACCGACG
GCTTTACGACCGATGGGCCGTGGGCGCTGCACCGGCTGTTCGACCGCGCGGCGGTGTCGGCCGGGCGCGG
CTCGGACCGGATGCTCGCGCGCTTCACGGTCGACGGCAAACCGCTCGTGCTGCAGGTGAATGCGGGCAGT
GTCCGCAACCCGTTCAGGCTGCCCCAGATGGAGTCCTTTACATGCCCTCCGAAGCAATGA
 Primer design