SecReT6
Protein ID: 402568955
SecReT6 ID689
T6SS typei3
Gene symbol-
Locus tagGEM_4215
StrainBurkholderia cepacia GG4
Repliconchromosome II [GenBank: NC_018514] [Browse all T6SS(s) in this replicon]
Location [Strand]1142110..1143429 [-]
Producthypothetical protein
NoteTssL
UniProt IDJ7J9G5
KEGG IDbct:GEM_4215
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-73, Aligned region: 50..254
OmpA [PF00691], Evalue: 2.90E-14, Aligned region: 251..260
OmpA [PF00691], Evalue: 2.90E-14, Aligned region: 319..417
Protein Sequence: 439 a.a.     [Download]
>gi|402568955|ref|YP_006618299.1| hypothetical protein GEM_4215 [Burkholderia cepacia GG4]
MNSSSDSISAGAGGFVPPNPGGMHPAAASGAAGPTATQPRPGRWAASGTNPLVAAANPLLNLVPQIRSTV
HHPNPAWLREHLVVEIRQFEARAQEAGVPSEAIIGARYGLCTALDEAAALTPWGGSVWSSHSLLVSFHNE
TWGGEKFFHLLERLSQQPRQHLDLLELLYFCLALGFEGRYRVLDNGHAQLDALRRQLAQTIRSVRGEFDP
ALSPHWRDVVSRDVARRFVVPLWVCVALALLIGFGVFVGLRIALAGHSDQLFTSIDALHVPKLQPAQAPP
RPAPVPRIAQFLAPQIAAGLVSVRDDADRSVIVLRGDGLFKSGSTSVIDRYTPVLARVADALNQVPGNVR
VTGYTDDTPVHTARFASNWDLSRERAEAVRSMIAARLGHPERLAAEGRGTLDPVAPNDSPTNRALNRRVE
ITLLPAPGNAAAGATQGAN
 
Nucleotide Sequence: 1320 bp     [Download]
>gi|402567932|ref|NC_018514.1|:c1143429-1142110 Burkholderia cepacia GG4 chromosome 2, complete sequence
ATGAATTCTTCCTCCGATTCGATTTCTGCCGGCGCCGGCGGATTCGTGCCGCCGAATCCGGGCGGCATGC
ATCCGGCGGCAGCGTCCGGTGCCGCCGGGCCGACAGCCACGCAGCCGCGGCCCGGTCGCTGGGCCGCGAG
CGGCACGAACCCGCTCGTCGCGGCCGCGAACCCGCTGCTCAACCTCGTGCCGCAGATCCGCTCGACCGTC
CATCATCCGAATCCGGCGTGGCTGCGCGAGCATCTCGTCGTCGAGATCCGCCAGTTCGAGGCACGCGCGC
AGGAGGCCGGCGTGCCGTCGGAGGCGATCATCGGCGCGCGCTACGGCCTGTGCACGGCGCTCGACGAAGC
GGCCGCGCTGACCCCGTGGGGCGGCAGCGTGTGGTCGTCGCACAGCCTGCTCGTGTCGTTCCACAACGAA
ACCTGGGGCGGCGAGAAGTTCTTCCACCTGCTCGAGCGCCTGTCGCAGCAACCGCGCCAGCATCTCGACC
TGCTGGAGCTGCTGTATTTCTGTCTCGCGCTCGGGTTCGAGGGCCGTTATCGCGTGCTCGACAACGGCCA
CGCGCAACTCGATGCGCTGCGCCGCCAGCTCGCGCAGACAATCCGCTCGGTGCGTGGCGAATTCGATCCC
GCGCTGTCGCCGCACTGGCGCGACGTCGTCTCGCGCGACGTCGCGCGCCGTTTCGTCGTGCCGCTGTGGG
TCTGCGTGGCGCTCGCGCTGCTGATCGGCTTCGGCGTGTTCGTCGGGCTGCGCATCGCGCTCGCCGGGCA
TTCGGACCAGCTGTTCACATCGATCGACGCGCTGCACGTGCCGAAACTGCAGCCCGCGCAGGCGCCGCCG
CGCCCGGCGCCGGTGCCGCGCATCGCGCAGTTCCTTGCGCCGCAAATCGCCGCCGGCCTGGTGTCGGTGC
GCGACGACGCCGATCGCAGCGTGATCGTGCTGCGCGGCGACGGGCTGTTCAAGTCCGGCTCGACGTCGGT
GATCGACCGTTACACGCCGGTGCTCGCGCGCGTCGCGGATGCACTGAACCAGGTGCCCGGCAACGTGCGC
GTGACCGGCTATACCGACGATACGCCCGTGCATACGGCGCGTTTCGCGTCGAACTGGGACCTGTCGCGCG
AACGGGCGGAGGCCGTGCGCAGCATGATCGCCGCGCGGCTCGGTCATCCGGAGCGGCTCGCGGCGGAAGG
GCGCGGCACGCTCGACCCGGTCGCGCCGAACGACTCGCCCACGAACCGCGCGCTGAACCGGCGTGTCGAG
ATCACGCTGCTGCCGGCACCCGGCAACGCCGCAGCCGGCGCGACGCAGGGGGCCAACTGA
 Primer design