SecReT6
Protein ID: 402568956
SecReT6 ID689
T6SS typei3
Gene symbol-
Locus tagGEM_4216
StrainBurkholderia cepacia GG4
Repliconchromosome II [GenBank: NC_018514] [Browse all T6SS(s) in this replicon]
Location [Strand]1143445..1144833 [-]
Producthypothetical protein
NoteTssK
UniProt IDJ7JHT9
KEGG IDbct:GEM_4216
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.90E-158, Aligned region: 30..461
Protein Sequence: 462 a.a.     [Download]
>gi|402568956|ref|YP_006618300.1| hypothetical protein GEM_4216 [Burkholderia cepacia GG4]
MTEPTMSATPVAALRQRVVWTEGMFLRPQHFQQLERHWERYVALRCLPLQGFYWGFDTLELDREQLALGK
VALRAAAGVMRDGTPFDLSHPDDLPEPLDVPTDAKDQLVVLALPLWRGGGEEMSFDAGGNGRGNGNVDVA
RYVVREYEVADANAVALGPALLQTGRLNVRLMLDTQLTGDWHALGVARIVERRTDARLLVDGGYIPPRLV
AQRDAALLAYTRELHGLLTQRSDALAERLSEPGRGGVSEVADFLLLQLVNRYLALTWHAQQDVATHPEAL
FRDWLKLACDLSTFTAAGRRPQSLAVYVHDDLRTSFAELMTELRRSLSTVLEQNAIQIELRDAGNGIRVA
TLADPALRDTAGFVLAVRADVPADSLRTRFPAQAKLGPVERIRDLVQLQLPGITMRQLPVAPRQIPYHAG
HTYFEIDKGSDLWKQLARSGGLAFHFAGEFPGLSMEFWAIRG
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|402567932|ref|NC_018514.1|:c1144833-1143445 Burkholderia cepacia GG4 chromosome 2, complete sequence
ATGACGGAACCGACGATGTCCGCGACACCGGTCGCCGCACTGCGCCAGCGCGTGGTGTGGACCGAAGGAA
TGTTCCTGCGGCCGCAGCATTTCCAGCAGCTCGAACGGCACTGGGAACGCTACGTCGCGCTGCGCTGCCT
GCCACTGCAAGGGTTCTACTGGGGCTTCGACACGCTCGAACTCGACCGCGAGCAGCTCGCGCTCGGCAAG
GTCGCGCTGCGCGCGGCGGCGGGCGTGATGCGCGACGGCACGCCGTTCGACCTGTCGCATCCCGACGATC
TGCCCGAGCCGCTCGACGTGCCGACCGATGCGAAGGACCAGCTCGTCGTGCTCGCGCTGCCGCTGTGGCG
CGGCGGCGGCGAGGAGATGTCGTTCGACGCAGGCGGCAACGGTCGCGGCAACGGCAACGTGGACGTCGCG
CGCTACGTCGTGCGCGAGTACGAAGTGGCCGATGCGAACGCGGTCGCGCTCGGCCCGGCATTGCTGCAGA
CGGGACGCCTGAACGTCAGGCTGATGCTCGACACCCAGCTGACCGGTGACTGGCATGCGCTCGGCGTCGC
GCGGATCGTCGAGCGGCGCACCGATGCGCGGCTGCTCGTCGACGGCGGCTATATTCCGCCACGCCTGGTC
GCACAGCGCGATGCCGCGCTGCTGGCGTACACGCGCGAGCTGCACGGACTGCTCACGCAGCGCAGCGACG
CGCTTGCCGAACGATTGTCGGAACCGGGGCGCGGCGGTGTGTCGGAAGTCGCTGACTTCCTGCTGCTGCA
GCTCGTGAACCGCTATCTGGCGCTGACCTGGCATGCGCAGCAGGACGTCGCGACCCATCCGGAGGCGCTG
TTCCGCGACTGGCTGAAGCTCGCGTGCGATCTCAGCACGTTCACGGCGGCGGGCCGGCGCCCGCAGTCGC
TCGCGGTCTACGTGCACGACGACCTGCGCACGAGCTTCGCCGAACTGATGACGGAGTTGCGCCGGTCGCT
GTCGACGGTGCTGGAGCAAAACGCGATCCAGATCGAGTTGCGCGACGCGGGCAACGGCATCCGGGTCGCG
ACGCTCGCCGATCCCGCGCTGCGCGACACGGCCGGCTTCGTGCTCGCGGTGCGCGCGGACGTGCCGGCCG
ACAGCCTGCGCACGCGGTTTCCCGCGCAGGCGAAACTCGGCCCGGTCGAGCGGATCCGTGACCTGGTGCA
GCTGCAGCTGCCGGGCATCACGATGCGCCAGTTGCCGGTCGCGCCGCGGCAGATCCCGTATCACGCGGGC
CATACGTACTTCGAGATCGACAAGGGCAGTGACCTGTGGAAGCAGCTGGCGCGCTCCGGCGGTCTCGCAT
TTCATTTCGCAGGCGAATTCCCGGGGCTCTCGATGGAGTTCTGGGCGATACGCGGGTGA
 Primer design