SecReT6
Protein ID: 402568957
SecReT6 ID689
T6SS typei3
Gene symbol-
Locus tagGEM_4217
StrainBurkholderia cepacia GG4
Repliconchromosome II [GenBank: NC_018514] [Browse all T6SS(s) in this replicon]
Location [Strand]1144830..1145345 [-]
Producthypothetical protein
NoteTssJ
UniProt IDJ7J8M2
KEGG IDbct:GEM_4217
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.90E-35, Aligned region: 15..158
Protein Sequence: 171 a.a.     [Download]
>gi|402568957|ref|YP_006618301.1| hypothetical protein GEM_4217 [Burkholderia cepacia GG4]
MRWRSSGFIVLGCVLLLPGCGATERAAAVPYAITVDVAPDVNLDVNRKPAPIVLKVFQLRAASTFDGADF
FSLQDKPGNVLGADLLGTDRMILRPGESRTLHYSGNVEAGAIGVVAEYRMLEKNRWRLTVPLPRAKPLNL
YKFWQTSPGELKLSIAVRNGGLALNDARGRP
 
Nucleotide Sequence: 516 bp     [Download]
>gi|402567932|ref|NC_018514.1|:c1145345-1144830 Burkholderia cepacia GG4 chromosome 2, complete sequence
ATGCGATGGCGGTCGAGCGGGTTCATCGTATTGGGGTGTGTATTGCTGTTGCCCGGATGCGGCGCGACCG
AGCGTGCGGCCGCGGTGCCGTATGCGATCACGGTCGACGTTGCGCCGGACGTCAACCTCGACGTCAACCG
CAAGCCTGCGCCGATCGTGCTGAAGGTGTTCCAGCTTCGCGCGGCGTCGACGTTCGATGGCGCGGACTTC
TTCTCGCTCCAGGACAAGCCCGGGAACGTCCTCGGCGCGGACCTGCTCGGCACCGACCGCATGATCCTGC
GGCCCGGCGAGTCGCGCACGCTGCACTACAGCGGCAATGTCGAGGCCGGTGCGATCGGCGTGGTCGCCGA
GTACCGCATGCTCGAAAAGAATCGCTGGCGCCTGACGGTGCCGTTGCCGCGCGCGAAACCGCTCAATCTC
TACAAGTTCTGGCAGACGTCGCCCGGCGAGCTGAAGCTGTCGATCGCGGTCAGGAACGGCGGTCTCGCGC
TGAACGACGCGCGGGGGCGCCCATGA
 Primer design