SecReT6
Protein ID: 402568959
SecReT6 ID689
T6SS typei3
Gene symbol-
Locus tagGEM_4219
StrainBurkholderia cepacia GG4
Repliconchromosome II [GenBank: NC_018514] [Browse all T6SS(s) in this replicon]
Location [Strand]1146412..1147839 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDJ7JE15
KEGG IDbct:GEM_4219
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.90E-10, Aligned region: 29..96
Protein Sequence: 475 a.a.     [Download]
>gi|402568959|ref|YP_006618303.1| FHA domain-containing protein [Burkholderia cepacia GG4]
MQLIVIEHAGEPVGNDSYDAVVFHPPGGTIGRATDNHLVLRDDTRQISRLQALLQVGDDACLLKNLSSVS
TIEVNREPVGYAQERPLHSGDIIRIGPYVLRAERDDGTGAPVVDMTSDSGASADLRCGPAAAARSHGETK
GAGNRLWGLLQNRFVPRGKESGVDVRSGPARTAAPQPASRAATAAPSAPSQRDLNQLSIDPLDLFAQSSS
DLGVSGSPSSDERSGAAERAAPSATQADHAPEWTQHVRVQPAAGRADTRPADEPAPQAARAPAPPTPDEL
LTAFFEGAGLDTAAASHQWSAEQLYIAGQLLALFANGTVELLSSRSILKREVKAHMTMLLDRENNPLKLL
PDGGAVLRQMFGLPLPGFMSPQSAVSDAFQDLHAHQIGMVAGMRAALMDLLTRFSPQRLRERDDAMRWYE
KRVPALYKARMWDRYAATHRDTVFAIEDDFASVFGKAFLAAYDAEVESYRGSSRH
 
Nucleotide Sequence: 1428 bp     [Download]
>gi|402567932|ref|NC_018514.1|:1146412-1147839 Burkholderia cepacia GG4 chromosome 2, complete sequence
ATGCAACTGATCGTGATCGAACATGCCGGCGAGCCGGTCGGAAACGACTCCTACGACGCTGTCGTGTTCC
ACCCGCCCGGCGGCACCATCGGCCGGGCGACCGACAATCATCTCGTGCTGCGCGACGACACCCGGCAGAT
TTCGCGGCTGCAGGCCCTGCTGCAGGTTGGCGACGACGCGTGCCTGCTGAAGAACCTGAGCAGCGTGTCG
ACGATCGAGGTGAACCGCGAGCCGGTCGGCTATGCGCAGGAGCGCCCGCTCCATAGCGGCGACATCATCC
GCATCGGGCCGTACGTGCTGCGGGCCGAACGTGACGACGGAACCGGCGCGCCGGTCGTCGACATGACCTC
CGATTCCGGCGCAAGCGCCGACCTGCGGTGCGGCCCGGCGGCTGCCGCGCGGTCTCACGGCGAGACGAAA
GGCGCCGGCAACCGGCTGTGGGGGCTGCTGCAGAATCGCTTCGTCCCGCGCGGCAAGGAGTCGGGCGTCG
ACGTTCGGTCGGGCCCGGCACGCACGGCGGCGCCGCAGCCGGCGAGCCGCGCTGCGACGGCCGCGCCCTC
CGCGCCATCGCAGCGCGACCTGAATCAGCTGTCGATCGATCCGCTCGACCTGTTCGCGCAGTCGTCGTCC
GATCTCGGCGTATCGGGTTCGCCTTCATCCGACGAACGCAGCGGCGCTGCCGAGCGCGCCGCGCCGTCCG
CGACGCAGGCCGACCACGCGCCCGAGTGGACGCAGCACGTGCGCGTGCAACCGGCGGCCGGGCGCGCCGA
TACCCGGCCGGCCGACGAGCCGGCGCCGCAGGCGGCCCGCGCGCCGGCACCGCCGACCCCTGATGAATTA
CTGACCGCGTTCTTCGAAGGCGCGGGGCTCGATACGGCCGCCGCATCGCATCAGTGGTCGGCCGAACAGC
TATACATCGCCGGGCAATTGCTGGCGCTGTTCGCGAACGGCACGGTCGAGCTGCTGTCGTCGCGCAGCAT
CCTGAAGCGGGAGGTGAAGGCGCACATGACGATGCTGCTCGATCGCGAGAACAACCCGCTGAAGCTGCTG
CCGGACGGTGGCGCCGTGCTGCGCCAGATGTTCGGACTGCCGCTGCCAGGCTTCATGTCGCCGCAGAGCG
CGGTCAGCGACGCGTTCCAGGATCTGCACGCGCACCAGATCGGCATGGTCGCCGGCATGCGCGCCGCGCT
GATGGACCTGCTGACGCGCTTTTCGCCGCAACGGCTGCGCGAGCGCGACGATGCGATGCGCTGGTACGAG
AAGCGCGTGCCCGCGCTCTACAAGGCGAGGATGTGGGATCGTTATGCCGCGACCCATCGCGACACGGTGT
TCGCGATCGAAGACGATTTCGCGTCGGTGTTCGGCAAGGCATTTCTTGCGGCGTACGACGCGGAAGTGGA
AAGCTATCGCGGCAGCAGCCGGCATTGA
 Primer design