SecReT6
Protein ID: 402780238
SecReT6 ID690
T6SS typeN/A
Gene symbol-
Locus tagA79E_1983
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2132167..2135577 [+]
Producthypothetical protein
NoteTssM
UniProt IDK4HD39
KEGG IDkpp:A79E_1983
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.00E-76, Aligned region: 416..734
DUF1215 [PF06744], Evalue: 2.90E-34, Aligned region: 632..681
DUF1215 [PF06744], Evalue: 2.90E-34, Aligned region: 855..973
Protein Sequence: 1136 a.a.     [Download]
>gi|402780238|ref|YP_006635784.1| hypothetical protein A79E_1983 [Klebsiella pneumoniae subsp. pneumoniae 1084]
MNIPGNGLGRFGLAGLTLAGMAAIWWGITRYGGMLNINTRGEQVLAFVQVCLALVFVFYLPAMSRRVKES
LYRRQSQQDSVLPGEEGRVALTPPHHITVGEIRQTLRYQYGRAWSRKVRILLIIGSVRDVEQLTPKLTQE
LWQEDQGTLLLWGGDPGAAVDNAWFTALRKLRYRPADGMVWVTSGFDGVLTTMNRTKPRLTPDEMDSVSH
SLKLRFEALGWKLPLYVWSLYEGGNEKNGRITQPVGCLLPAGCTPQIVAEQFTALASLLIEQGIQQICGQ
PQHNFLLALADQLTRKPETVTEPLSVLLNPYRPQPLAGVVFSEASVEAGRSVRHHWGRDNRWETIPDSVL
WLPAGLRPRKQGVNWMRGMSVAAAALMLLWAASMTVSFIANRHLVAIAQEQVQQASAGKQPLAVRLHALS
ALQKTLSQLEYRSQHGAPWYLRAGLSQNDDLLAALFPRYGERAQPLLRDAAAHHLEEQLTAFVQLPPDSP
LREKMTKTAYGQLKQYLMLTRPEKMDAAWFATTLMQDWPQRSGIADAVWQGSGPSLLAFYAASLASHPQW
RLPVDDGLVSQVRTRLIRQMGQRNSESTLYQKMLAQVANQYADMRLADMTADTDASRLFSTDEVVPGMFT
RQAWEQAVQPAIEKVVAERRDEMDWVLSDTKQTAAQSTLPEALRARLAERYFADFSGAWLDFLNSLRWQR
AATLSDAIDQLTLMADVRQSPLVALMNTLRVQGRTGQTGEAIADSLVKSARQLFNRDNPPVIDQRSGARG
PLDATFGPVLALLDNRDGGTPTSRLSLQTFLTRVTQVRLRLQQVTNATDPQAMTRLLAQTVFQGKAVDLT
ETRDYGSLVAAGLGQEWSGFGQTLFVRPMEQAWQQVLTPAAESLNAQWRSAVVEDWNSAFGGRYPFKNTS
SEVSLPLLAKYLDSETGRIARFLQTRLNGVLHKEGSRWMADSINAQGLTFNPAFLEAMNTLSHLSDVAFA
NGEAGLHFALRPGTADGVMQTELVIDSQKLVYMNQMPVWRRFSWPADTEAPGASLSWVSTRAGTRQYGDF
PGAWGWIRLLDKAVVSAYPGTSSSWSLSWKAPDGLLLNYTLRTEAGEGPLALLALRNFTLPETIFSVRAS
AERVPLTDDIPGEEGY
 
Nucleotide Sequence: 3411 bp     [Download]
>gi|402778297|ref|NC_018522.1|:2132167-2135577 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGAATATACCGGGTAATGGCCTGGGCCGGTTTGGCCTGGCCGGGCTTACGTTGGCCGGGATGGCTGCAA
TATGGTGGGGGATCACCCGCTATGGCGGCATGCTGAATATCAATACGCGGGGCGAGCAGGTACTGGCGTT
TGTCCAGGTCTGTCTGGCGTTGGTATTTGTTTTTTACCTTCCTGCAATGTCCCGCCGTGTGAAGGAGAGT
TTATATCGCCGGCAGTCGCAGCAGGACAGCGTCTTACCCGGCGAAGAAGGGCGCGTGGCGCTGACACCTC
CCCATCATATTACGGTGGGGGAAATTCGCCAGACTCTACGCTATCAGTATGGACGCGCCTGGTCCCGCAA
AGTCCGTATTCTGCTGATAATTGGCTCAGTCAGAGACGTAGAACAACTGACCCCAAAGCTCACGCAGGAA
CTCTGGCAGGAAGATCAGGGTACATTATTGCTGTGGGGTGGAGACCCTGGGGCAGCGGTAGATAACGCCT
GGTTCACAGCGCTGCGTAAACTGCGTTATCGCCCGGCTGATGGTATGGTGTGGGTAACATCGGGCTTTGA
CGGCGTTTTGACAACGATGAACAGAACGAAGCCCAGGCTCACGCCAGATGAAATGGACAGTGTGTCTCAC
TCTCTAAAGCTACGCTTCGAAGCTCTTGGCTGGAAACTACCCCTATACGTCTGGTCGCTGTATGAGGGGG
GCAACGAAAAAAATGGACGTATCACTCAGCCTGTGGGCTGCCTGTTACCTGCAGGTTGTACGCCGCAAAT
AGTTGCCGAACAGTTCACTGCCCTGGCGTCGTTACTGATAGAGCAGGGCATCCAGCAGATATGCGGGCAA
CCACAGCACAATTTTTTACTCGCGCTGGCCGATCAGTTGACCCGTAAACCGGAAACGGTGACGGAGCCGT
TATCGGTATTGCTTAATCCTTACCGCCCGCAGCCGCTGGCCGGGGTGGTATTTAGTGAGGCGTCAGTAGA
GGCTGGTCGCAGTGTCCGTCATCACTGGGGACGGGATAACCGCTGGGAAACGATACCAGACTCAGTGCTG
TGGTTGCCAGCCGGTCTACGTCCGCGCAAACAGGGAGTCAACTGGATGCGTGGGATGAGCGTGGCCGCCG
CCGCCCTGATGTTACTCTGGGCCGCCTCAATGACAGTCTCTTTTATCGCCAACCGCCACCTGGTGGCGAT
CGCACAGGAGCAGGTGCAGCAGGCCTCGGCGGGAAAACAGCCGCTGGCCGTACGCCTGCATGCGCTCTCC
GCGTTACAGAAAACGCTTTCTCAACTGGAATACCGCTCGCAGCACGGAGCGCCGTGGTACCTCCGCGCAG
GCCTCAGTCAGAACGATGACCTGCTGGCGGCGCTGTTCCCGCGCTACGGAGAGAGGGCGCAGCCGCTGCT
GCGCGATGCGGCGGCGCATCATCTGGAAGAGCAGCTCACCGCTTTCGTGCAGCTGCCGCCGGACAGCCCA
CTGCGTGAGAAGATGACGAAGACCGCTTACGGACAACTGAAACAATATCTGATGTTGACCCGCCCGGAAA
AAATGGACGCCGCGTGGTTCGCCACTACGCTAATGCAGGACTGGCCGCAGCGCTCAGGCATCGCCGACGC
CGTCTGGCAGGGCAGCGGCCCTTCGCTGCTGGCATTTTATGCCGCCAGTCTGGCGTCGCATCCGCAGTGG
CGTCTGCCTGTCGATGACGGTCTGGTCAGCCAGGTGCGCACACGGTTAATTCGACAGATGGGCCAGCGCA
ACAGTGAGTCCACGCTTTACCAGAAGATGCTCGCGCAGGTGGCGAATCAGTATGCCGATATGCGCCTGGC
GGATATGACTGCCGACACCGATGCTTCGCGTCTGTTCAGCACTGATGAGGTGGTGCCGGGAATGTTTACC
CGTCAGGCCTGGGAGCAGGCCGTGCAGCCGGCCATTGAGAAAGTGGTCGCGGAACGCCGCGATGAAATGG
ACTGGGTGCTGAGTGATACGAAGCAGACTGCCGCGCAGTCGACGTTGCCGGAAGCTCTGCGAGCCAGGCT
GGCGGAGCGTTATTTCGCTGATTTTAGCGGCGCCTGGCTGGATTTCCTCAACAGTCTGCGCTGGCAGCGC
GCGGCAACCCTCTCCGATGCTATCGACCAGCTGACCCTGATGGCCGATGTGCGCCAGTCGCCGCTGGTGG
CGCTGATGAACACCCTGCGCGTGCAGGGGCGAACCGGCCAGACCGGGGAAGCCATCGCCGATTCGCTGGT
CAAATCGGCCAGGCAGCTGTTCAACCGTGACAACCCGCCCGTCATCGATCAACGGTCCGGCGCGCGCGGT
CCTCTGGATGCCACCTTCGGGCCCGTACTGGCGCTGCTGGACAATCGCGACGGCGGGACACCCACCAGCC
GTCTTAGCCTGCAGACCTTCCTGACCCGCGTCACCCAGGTGCGTCTGCGCCTGCAGCAGGTCACCAACGC
CACCGATCCGCAGGCGATGACCCGGTTGCTTGCGCAGACGGTATTCCAGGGCAAGGCCGTGGATTTAACC
GAAACGCGCGACTACGGCAGCCTGGTGGCGGCGGGGCTGGGCCAGGAGTGGAGTGGATTTGGGCAAACGC
TGTTTGTTCGCCCAATGGAACAGGCCTGGCAGCAGGTGCTGACCCCGGCGGCGGAAAGCCTCAACGCCCA
GTGGCGCAGCGCGGTGGTGGAGGACTGGAATAGCGCTTTTGGCGGTCGCTACCCCTTTAAAAATACCAGC
AGTGAAGTCTCTCTGCCGCTGCTGGCAAAATACCTCGACAGCGAGACCGGGCGCATCGCCCGCTTTCTGC
AGACCCGGCTGAACGGCGTGCTGCATAAAGAGGGGAGCCGCTGGATGGCGGACAGTATCAATGCTCAGGG
GCTGACGTTTAACCCGGCCTTTCTGGAGGCGATGAATACCCTGAGCCATCTCTCCGACGTCGCGTTCGCC
AACGGCGAAGCGGGATTGCATTTTGCGCTTCGCCCCGGCACGGCGGACGGCGTGATGCAGACGGAGCTGG
TCATCGACAGTCAGAAACTTGTCTATATGAACCAGATGCCGGTCTGGCGGCGGTTCAGCTGGCCCGCTGA
CACCGAAGCGCCGGGCGCCAGTCTGAGCTGGGTCAGTACCCGGGCGGGCACCCGCCAGTATGGCGATTTC
CCGGGCGCCTGGGGGTGGATCCGTCTGCTGGATAAGGCGGTGGTCAGCGCTTATCCCGGAACGAGCAGCA
GCTGGAGCCTGAGCTGGAAAGCGCCGGATGGTCTGTTGCTGAACTACACGCTGCGTACCGAGGCGGGGGA
AGGACCGCTGGCGCTGCTGGCGCTGCGAAACTTTACGCTACCGGAGACGATATTCAGCGTGCGCGCGTCT
GCTGAACGTGTTCCGCTGACCGACGATATACCCGGCGAAGAGGGATACTGA
 Primer design