SecReT6
Protein ID: 402781073
SecReT6 ID691
T6SS typei2
Gene symbol-
Locus tagA79E_2824
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2980283..2983786 [-]
Producthypothetical protein
NoteTssM
UniProt IDK4H5E4
KEGG IDkpp:A79E_2824
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.00E-70, Aligned region: 442..760
DUF1215 [PF06744], Evalue: 1.70E-33, Aligned region: 279..303
DUF1215 [PF06744], Evalue: 1.70E-33, Aligned region: 883..1003
Protein Sequence: 1167 a.a.     [Download]
>gi|402781073|ref|YP_006636619.1| hypothetical protein A79E_2824 [Klebsiella pneumoniae subsp. pneumoniae 1084]
MEHAYYPDSFKTGDGSVKLLLAPKTTEGRYLSVVFILFLLLAAMTFIVWKHPDMAGLEGDSQQQNYWLIG
GCCITGCIFIMLVMLLWTARSAGKKEFEALLDVTRGDDNKRKDESENISVSPAVVMCARIRDHLRTRIGI
HWRRKVRLLLVTGDEAAIEQLVPGLRQQHWLEGNRTVLIYGGSLASEPDREKYIALRKLRRGRPLDGIVR
VMPSSLTLTPQISESDLHGLEKISELLGYAAPVWLWKLCDSEWPQADRAVQAVGVSFPLRATEDDVARQL
AQMLPTLREQGMRQIAEETRHDFLLRLGQQLIDGGIAQWRWQLAPWLTASRQRLALRGLMFSLPEPRTVD
PYQEADTSPVGQPHLLTLPATWLGIVDDCRRLRGHHVGMAWERGLACGLLAILGLWAAGLLLSFALNYSQ
IASVAGKARDLVAHPSVSDYQLTALHALRNEAGRLVHDGQKGAPWYRRFGLDHHQQLLNAVLPWYGVANH
RLIRDPANAALQQALNALVNSAPNSDQRAKLAKPGYDQLKAWLMMARPDKADGAFFAQTMKTVQPTRMGI
STGLWQSLAPDLWAFYLSLLPERPEWKIIPDAQRVSQSRQVLLQQLGRRNAESTLYENMLKSVRRNFADV
SLEDMTSGTDARRLFTTDEVVPGMFTRQAWEGGIQQAIDKAASSRREEIDWVLSDSRKTVSTDLSPEALK
ARLTRRYFTDFAGSWLNFLNSLRLNPATNIADVTDQLTLISDVRQSPLIALMNTLAWQGQAGQQREGLSD
SLIKSAKDLVGGKDKPVIDQSAAGPQGPLDDTFGPLLQLMGKNTGSNVMSADSTLSLQTYLTRITRVRLR
LQQVANASDPQVMMQTLAQTVFQGKSVDLTDTQQYGSLISASLGEEWSGFGNTLFVQPLTQAWETVLLPS
AASLNDKWRRSVVANWHTAFDGRFPFAASKSDASLPMLAEFVRKDSGRIERFLTTELNGVLHKEGSQWVP
DKVNSHGLVFNPAFLRAIDQLSQLSDILFTDGSQGISFELQARPAPEVVETQLTIDGQKLRYFNQMADWQ
TFRWPGETYKPGTLLTWTTVNAGTRLFGDYSGTWGFIRWLEQGKRHPLDRSQWMMSFSAPDGRTLQWVLR
SQLGSGPLALLALRGLTLPDQIFTVDAAESAQALTTGVGNSDMDEME
 
Nucleotide Sequence: 3504 bp     [Download]
>gi|402778297|ref|NC_018522.1|:c2983786-2980283 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGGAGCACGCTTATTACCCCGATAGCTTCAAGACAGGAGATGGATCTGTGAAGTTACTTTTAGCACCGA
AAACTACGGAAGGTCGCTATCTTTCAGTCGTATTCATTCTCTTTTTACTCTTGGCTGCAATGACATTTAT
CGTCTGGAAACATCCTGACATGGCCGGACTTGAGGGCGATAGTCAGCAGCAGAATTACTGGCTTATTGGT
GGGTGCTGCATTACCGGATGTATCTTTATCATGTTAGTTATGCTCCTGTGGACAGCTCGCAGTGCCGGTA
AAAAGGAGTTTGAGGCGCTCCTGGATGTCACTCGTGGTGATGACAATAAGAGAAAAGATGAGAGTGAAAA
CATCTCTGTTTCTCCAGCAGTGGTGATGTGTGCCAGGATTCGTGACCATCTGCGAACCCGAATTGGAATT
CACTGGCGGCGCAAAGTCCGCCTGCTTTTAGTCACCGGCGACGAGGCGGCAATCGAACAACTGGTGCCTG
GCCTGCGTCAGCAGCACTGGCTTGAAGGCAACCGCACCGTGCTGATTTACGGCGGCAGCCTTGCATCGGA
GCCTGACCGAGAAAAATACATCGCGCTGCGCAAGCTGCGCCGTGGCCGTCCTCTGGACGGAATTGTGCGG
GTGATGCCGTCGTCTCTCACCCTGACGCCGCAGATAAGCGAGAGCGACCTGCACGGGCTGGAAAAAATCA
GCGAACTGCTGGGCTATGCCGCCCCGGTCTGGTTGTGGAAACTATGCGATAGTGAGTGGCCGCAGGCTGA
CCGCGCGGTGCAGGCGGTAGGGGTTAGCTTCCCGTTGCGCGCTACCGAGGACGATGTCGCCCGTCAGCTT
GCGCAGATGCTGCCCACGCTGCGGGAGCAGGGGATGCGCCAGATCGCGGAGGAGACCCGCCACGACTTTC
TGCTGCGTCTGGGACAGCAGCTTATCGACGGGGGGATCGCGCAATGGCGCTGGCAGCTGGCGCCGTGGCT
GACCGCCTCGCGGCAGCGGCTTGCGCTGCGAGGCCTGATGTTTAGCCTGCCAGAGCCTCGTACCGTAGAT
CCGTATCAGGAGGCGGATACCTCGCCTGTGGGCCAGCCTCATCTCCTGACGCTGCCCGCCACCTGGCTGG
GGATCGTCGATGACTGCCGCCGTTTACGCGGGCATCACGTGGGAATGGCGTGGGAGCGGGGCCTGGCGTG
CGGTCTGCTGGCCATCCTCGGCCTGTGGGCGGCGGGACTGCTGCTCTCCTTTGCCCTCAATTACAGTCAG
ATTGCTTCGGTAGCGGGAAAAGCCCGCGACCTGGTGGCCCACCCCTCCGTTTCTGACTATCAACTGACGG
CCCTCCATGCCCTGCGCAATGAGGCCGGCCGTCTCGTGCACGATGGGCAGAAGGGGGCGCCCTGGTATCG
GCGCTTTGGTCTGGACCATCATCAGCAACTATTAAACGCCGTCCTACCCTGGTACGGTGTGGCAAATCAT
CGCCTGATACGTGACCCGGCCAATGCCGCGTTGCAGCAGGCGCTCAACGCGCTGGTCAACTCCGCCCCCA
ATAGCGACCAACGAGCCAAGCTGGCGAAACCGGGCTATGACCAGCTGAAAGCCTGGCTGATGATGGCTCG
TCCGGATAAAGCCGATGGCGCATTTTTTGCGCAGACCATGAAAACGGTCCAGCCGACGCGAATGGGGATC
TCGACCGGTCTGTGGCAAAGTCTGGCGCCGGATTTGTGGGCCTTTTATCTCTCCCTGCTGCCCGAGCGGC
CAGAGTGGAAGATCATCCCGGATGCGCAACGGGTGAGTCAGAGCCGTCAGGTTCTGTTGCAGCAGCTAGG
TCGCCGCAATGCCGAAAGCACCTTATATGAGAACATGCTCAAATCCGTGCGTCGTAATTTTGCCGATGTA
TCGCTGGAAGACATGACCAGTGGCACCGATGCGCGCCGGCTGTTTACCACCGATGAAGTGGTCCCGGGGA
TGTTTACCCGCCAGGCATGGGAAGGCGGCATTCAGCAGGCCATTGATAAGGCAGCCAGCTCGCGCCGGGA
GGAAATCGACTGGGTGCTGAGCGATTCGCGCAAAACGGTGTCGACAGACCTGTCGCCGGAGGCGCTGAAA
GCGCGTCTGACCCGACGCTACTTCACCGATTTCGCCGGCAGCTGGCTGAATTTTCTCAACAGTCTGCGAC
TTAATCCGGCGACCAATATCGCCGATGTTACCGACCAGCTCACGCTGATTAGCGATGTCCGCCAGTCGCC
GCTGATTGCCCTGATGAATACCCTTGCCTGGCAGGGGCAGGCGGGGCAACAAAGGGAGGGGCTGTCGGAC
AGCCTTATTAAATCGGCCAAAGATCTGGTGGGCGGGAAAGACAAGCCGGTCATCGACCAGTCGGCAGCCG
GCCCGCAGGGGCCTCTGGATGACACGTTCGGCCCACTGCTCCAGCTGATGGGGAAAAACACGGGCAGCAA
CGTCATGTCGGCCGATAGCACCCTGAGCCTGCAAACCTATCTGACCCGTATCACCCGCGTGCGCCTGCGC
CTGCAGCAGGTTGCGAATGCTTCCGATCCGCAGGTGATGATGCAGACCCTGGCGCAGACCGTCTTCCAGG
GGAAAAGCGTCGACCTGACCGACACGCAACAGTACGGTAGCCTGATTTCGGCAAGCCTTGGCGAAGAGTG
GAGTGGCTTCGGTAATACTCTGTTTGTGCAGCCGCTGACTCAGGCCTGGGAAACCGTGCTTCTGCCGTCG
GCGGCCAGTCTGAATGATAAATGGCGCCGCTCGGTGGTCGCCAACTGGCACACCGCCTTTGACGGACGCT
TTCCGTTTGCCGCCAGCAAAAGCGACGCCTCCCTGCCGATGCTGGCTGAGTTTGTGCGCAAAGACAGCGG
GCGAATCGAACGTTTTCTCACGACGGAGCTGAACGGTGTCCTGCATAAAGAAGGTAGTCAGTGGGTGCCG
GATAAGGTCAACAGTCACGGCCTGGTCTTTAATCCGGCCTTTCTGCGCGCGATCGACCAGCTAAGCCAGC
TGTCCGACATTCTTTTCACCGACGGCAGCCAGGGGATCAGCTTTGAGTTACAGGCCAGGCCTGCCCCGGA
GGTTGTCGAGACACAGCTGACGATAGACGGCCAAAAGCTGCGCTATTTCAATCAGATGGCCGACTGGCAG
ACTTTCCGCTGGCCGGGGGAGACGTATAAACCCGGCACTCTGCTGACCTGGACCACCGTCAATGCGGGAA
CGCGTCTGTTCGGTGACTACAGCGGTACCTGGGGCTTTATTCGCTGGCTGGAGCAGGGTAAACGCCATCC
GCTGGATCGCAGCCAGTGGATGATGAGCTTCTCCGCTCCGGATGGCCGCACCCTGCAGTGGGTATTGCGC
TCCCAGCTTGGGAGTGGCCCGCTGGCGCTTCTGGCGCTGCGCGGATTGACCCTGCCGGATCAGATTTTCA
CTGTCGATGCGGCTGAGAGCGCACAGGCCCTGACGACGGGGGTAGGGAATAGTGACATGGATGAGATGGA
ATAA
 Primer design