SecReT6
Protein ID: 403059668
SecReT6 ID692
T6SS typei1
Gene symbol-
Locus tagPCC21_032290
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]3652224..3655721 [-]
ProductIcmF-like protein
NoteTssM
UniProt IDJ7L2J0
KEGG IDpcc:PCC21_032290
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.50E-93, Aligned region: 252..293
IcmF-related [PF06761], Evalue: 2.50E-93, Aligned region: 505..819
ImcF-related_N [PF14331], Evalue: 8.80E-71, Aligned region: 200..457
DUF1215 [PF06744], Evalue: 3.90E-31, Aligned region: 905..1023
Protein Sequence: 1165 a.a.     [Download]
>gi|403059668|ref|YP_006647885.1| IcmF-like protein [Pectobacterium carotovorum subsp. carotovorum PCC21]
MFKTIITFLRKQLPKLKLSWLLLGVLLWVVVLVLAWWLGPRLTVGESRPLQGIWGRVVFTLVWLWLAFSY
SAWLVWRRVQQMRAERHEQQVIEQDPLQVYVDSQQTFLDRWLEAFQTQLGKRALYAMPWYLTIGLAGSGK
SSLIHRANPANKMNPKLDAELRDVAAGQQVSSWVGESAVIWDPSGQLLAQPELEGDSLGQRHARLWQHLL
QWLSENRRRQPLNGLVLTLDISWLAQAGVADRKAYAQVMRARMQEISVNINTRLPVYIALTRLDMLSGFD
KVYRQLNREARQAVLGVTFTPQASNSKGWLEELERFWDEWVTHLNDNLPDMLLTQSDRSVRNSLFSFVRQ
LAGVKDYVMEVLTETLATGEDRAFLIRGVYVSSVYQQGVPFDAFAQSASRRYQLPEPINPALRGESNTFF
VQRLFPDVIFPEASLAGENRLHSLYRRRRLSIGVGCMLLASLALIGSWHHFYRVNEEAGRNVLTKAQAFI
GTNELEGQQGYGYQQLPRLNLIRDATLSFGNYHERTPLLADLGLYQGDKIGPHVEGTYLQMLNQRFLPAV
MQGLLEDLNQAPANSEQKLTILRVMRMLDDASGRNKALVEQFMAQRWQKAFPGQGNVQEQLMQHLDYALE
HTDWHKAREQKDAVAISTFAPFNGPITLAQQELSKLPMYQRVYQSLVMKATQVLPPDLAIRDEVGPTFDP
VFSLRNDKAGSVPRLLTYPGFSDYYLKQDKALLELTALDAWVLGQRERAQFSEADRREILRQVNDRYITD
YINQWQKVLANIDVQTLDTPEQALDILTDITGNDQPFQRVLTTVSDNTRIRKLSDDDNDTAQSINTRTGR
PFMTINAALSGRGEQGPLVQEVNQKLTDLYHYLDQIVNATDPGQAALKAVQARQGNKFADPVFALQQYAR
SLPAPLDRWVGQLAGESASLVTGLAMSSLNQEWLDKVVTPFNEKLADRYPFDPSSNKDVPLSEMEMFFMT
GGTLDSFYQTNLKAMMESGMLEEGMASPLQAELVKQLERATRIRQTLFNAQGSLEVHFVLEPLELTANKR
RSVLNLDGQLLEYSHGRRQKTPLVWPNSMRDGAESKLTLVPDDRERSPRSLSFSGPWAMFRLINSDQLTQ
VNENTFDVRFSLENGAMTYRVYTDASHNPFAGGLFSQFTLPDSLY
 
Nucleotide Sequence: 3498 bp     [Download]
>gi|403056439|ref|NC_018525.1|:c3655721-3652224 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
ATGTTTAAAACAATCATAACCTTTCTACGCAAGCAGTTACCTAAACTGAAACTCTCCTGGTTACTTTTGG
GCGTGCTGCTGTGGGTCGTCGTGTTGGTTCTGGCCTGGTGGCTGGGGCCGCGTTTGACGGTGGGCGAGTC
GCGTCCGTTGCAGGGAATCTGGGGCCGCGTGGTGTTCACGCTGGTTTGGCTGTGGCTGGCGTTTTCCTAC
AGCGCCTGGCTGGTCTGGCGTCGCGTGCAGCAGATGCGGGCGGAGCGTCATGAGCAGCAGGTGATTGAAC
AGGATCCCTTGCAGGTGTATGTCGACAGCCAGCAAACGTTTCTCGACCGCTGGCTGGAGGCGTTTCAGAC
CCAGTTGGGTAAACGCGCGCTGTACGCGATGCCCTGGTATCTGACGATTGGTCTGGCTGGCAGCGGGAAA
AGTAGCCTGATCCATCGCGCTAATCCGGCAAACAAAATGAATCCGAAGCTGGATGCGGAGCTGCGAGACG
TGGCGGCAGGCCAGCAGGTGAGCAGTTGGGTCGGCGAATCCGCGGTGATTTGGGACCCAAGCGGACAGCT
ACTTGCCCAGCCTGAGCTGGAAGGCGATTCGCTCGGACAACGTCATGCTCGACTGTGGCAGCACCTGTTG
CAGTGGCTCAGTGAAAACCGCCGCCGCCAGCCGCTCAACGGTCTGGTGCTCACGCTGGATATCTCCTGGC
TGGCGCAGGCTGGCGTCGCCGATCGCAAAGCTTACGCGCAGGTGATGCGCGCCCGCATGCAGGAGATTTC
CGTCAACATCAATACGCGCTTACCGGTATATATCGCGCTGACCCGGCTGGATATGCTGAGTGGCTTCGAT
AAGGTCTATCGCCAGTTGAACCGCGAGGCGCGTCAGGCCGTATTAGGGGTGACGTTTACGCCGCAGGCGA
GCAACAGCAAAGGCTGGTTAGAAGAGCTGGAGCGCTTCTGGGACGAGTGGGTCACGCACCTGAATGACAA
CCTGCCGGATATGCTGCTGACGCAATCCGACAGAAGCGTGCGCAATTCGCTGTTCTCGTTCGTTCGCCAA
CTGGCTGGGGTGAAAGATTATGTGATGGAAGTGCTGACGGAAACGTTAGCGACGGGCGAGGATCGCGCGT
TCCTGATCCGCGGCGTCTACGTCAGTTCTGTCTACCAACAAGGGGTGCCGTTCGATGCCTTTGCGCAATC
GGCTTCCCGCCGCTATCAACTGCCAGAGCCGATTAACCCTGCGCTGCGCGGTGAATCCAATACGTTCTTT
GTGCAACGTCTCTTCCCTGACGTCATTTTCCCTGAGGCCAGTCTGGCGGGGGAAAACCGGCTGCATAGCC
TCTATCGTCGGCGTCGGCTGAGTATCGGCGTGGGCTGCATGTTGCTCGCCAGTCTGGCGCTGATTGGCAG
CTGGCACCATTTCTATCGGGTCAATGAAGAGGCGGGACGTAACGTCCTGACAAAAGCACAGGCCTTTATC
GGCACCAATGAGCTGGAAGGCCAGCAGGGTTACGGCTATCAGCAGTTGCCGCGTCTGAATTTGATTCGCG
ATGCGACCTTATCCTTTGGTAATTACCACGAGCGCACGCCGCTGCTGGCCGATCTTGGTCTGTATCAGGG
CGACAAGATTGGCCCTCATGTTGAAGGCACCTATCTGCAAATGCTGAATCAGCGCTTTCTCCCGGCGGTG
ATGCAAGGGCTTCTGGAAGATCTGAATCAGGCACCGGCCAATAGTGAGCAAAAACTGACGATTCTGCGCG
TGATGCGGATGCTGGATGATGCGTCAGGGCGCAATAAAGCGCTGGTCGAACAGTTTATGGCGCAGCGCTG
GCAGAAGGCATTTCCCGGACAGGGCAACGTGCAGGAACAGCTGATGCAGCATCTGGATTATGCCCTTGAG
CACACCGACTGGCACAAGGCTCGTGAGCAGAAAGACGCGGTAGCGATCAGCACGTTCGCGCCATTTAATG
GACCGATTACGCTGGCCCAGCAGGAACTGAGCAAGCTGCCGATGTATCAGCGCGTTTACCAGAGTCTGGT
GATGAAGGCGACACAGGTGCTGCCGCCGGATTTAGCGATTCGTGACGAAGTCGGGCCGACCTTTGACCCG
GTGTTTTCTCTGCGTAATGACAAAGCGGGAAGTGTGCCTCGGCTGCTGACGTATCCCGGCTTTAGTGATT
ATTACCTCAAGCAGGACAAAGCGCTGTTAGAGCTGACGGCACTGGACGCCTGGGTGCTGGGACAGCGTGA
GCGTGCGCAGTTCAGCGAGGCCGATCGGCGGGAAATTCTGCGCCAGGTGAATGACCGCTACATTACGGAT
TACATCAACCAGTGGCAGAAAGTGCTGGCGAACATTGATGTGCAGACGCTCGATACGCCGGAGCAGGCGC
TCGACATTCTCACGGATATTACTGGCAACGATCAGCCTTTTCAGCGCGTGCTGACTACGGTCAGTGACAA
CACCCGTATCCGTAAGCTATCCGATGATGATAACGACACGGCGCAGAGTATTAACACGCGTACTGGTCGT
CCGTTTATGACCATCAATGCGGCGCTGAGCGGACGCGGTGAGCAGGGGCCGCTGGTGCAAGAGGTCAATC
AGAAGCTGACCGATCTCTATCACTATCTCGATCAGATCGTTAACGCAACCGATCCGGGACAGGCGGCGTT
GAAAGCGGTGCAGGCGCGGCAGGGAAATAAATTTGCCGATCCGGTATTCGCCTTACAGCAATACGCCCGC
AGCCTTCCCGCGCCGCTGGATCGCTGGGTAGGACAATTAGCCGGAGAGAGCGCGAGTCTGGTGACCGGGC
TGGCGATGTCGTCGCTGAATCAGGAATGGCTGGATAAGGTCGTCACGCCATTCAATGAGAAGCTGGCAGA
TCGTTATCCCTTCGACCCGTCATCGAACAAGGATGTGCCGCTATCGGAAATGGAAATGTTCTTCATGACT
GGCGGGACGCTGGACAGCTTCTATCAAACCAACCTCAAGGCGATGATGGAGAGCGGCATGCTGGAAGAAG
GCATGGCATCGCCTCTGCAGGCTGAGCTGGTGAAACAGCTTGAACGCGCTACCCGCATCCGCCAGACCCT
GTTTAATGCACAGGGCAGCCTGGAAGTGCATTTCGTTCTGGAGCCGCTGGAACTGACGGCGAACAAGCGC
CGCAGCGTGCTGAATCTGGACGGACAACTGCTGGAATACAGCCACGGTCGTCGCCAGAAAACGCCGCTGG
TGTGGCCAAACAGTATGCGCGACGGGGCTGAGAGCAAGCTGACACTGGTGCCGGACGATCGTGAGCGTTC
TCCGCGTAGCCTGAGCTTTAGCGGACCGTGGGCGATGTTCCGCTTAATCAATAGCGATCAGCTGACTCAG
GTGAATGAGAACACCTTCGACGTGCGCTTCTCGCTGGAGAACGGGGCGATGACCTATCGCGTGTATACCG
ATGCCAGCCATAACCCGTTTGCCGGTGGTCTGTTCAGCCAGTTCACGCTGCCTGACTCGCTTTATTAA
 Primer design