SecReT6
Protein ID: 403521396
SecReT6 ID694
T6SS typei3
Gene symbol-
Locus tagBPC006_II0102
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]88359..91139 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDK7Q5F0
KEGG IDbpq:BPC006_II0102
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-57, Aligned region: 47..378
DUF2345 [PF10106], Evalue: 2.70E-42, Aligned region: 614..646
DUF2345 [PF10106], Evalue: 2.70E-42, Aligned region: 698..849
T6SS_Vgr [PF13296], Evalue: 3.20E-39, Aligned region: 563..671
T6SS_Vgr [PF13296], Evalue: 3.20E-39, Aligned region: 738..803
Phage_base_V [PF04717], Evalue: 1.30E-18, Aligned region: 462..546
Protein Sequence: 926 a.a.     [Download]
>gi|403521396|ref|YP_006656965.1| Rhs element Vgr protein [Burkholderia pseudomallei BPC006]
MTNLNDTLRNFASGAVDWNKRPVALHFGAAQAALGHLLALQHASVQEGLMTGIHGRLTCVSTRRDLPPGV
LLGIPVSIRLITDRGQPHTVNAIISGVQIGQSDGELCVYQLTVCDALSLMDKRTNSRVFRKRSVIEVLAT
LFNEWQQRSPALARAFEFDLSGLRADRYPPRELTRQVNESDAHFVRRLLRREGITVFAKAGPAKGERPLQ
GDAPVHTLVCCDDPMSLPQAPAGTVRLHPRDGGAAQRDTVTLFALRRQLAPGKAGRPSWDYKKARIDESS
VASSLDQGEAGNDLAKLLTDIAIDIAHAGDSWRDHERLTRARMLAHEFEAERHDGVSSVRDLAVGTWITL
TGDPQWDRQRADKRQFVITSIDHDIWNNLPKGLNERVHALFAASRNLACAPRALPSALANDADTRYENTF
ACVRRGVPLAPAYDPQADLPPAHLLTGTIVGAEGEEVFCDEDGRVRVRVHGLDPADHAHAQGAGTNGNAG
DSAPIRVASSLAGAYFGASFLPRVGMEVLLGCLGGDPDRLVIIGVLGNGAHPPATFSHAGGLPGNRYLSG
IKTKEIRGQRYNQLRLDDTPNQISAQLASEHAHSQLNLGYLTQPRENGHGNDRGEGVELRTDAAAALRAA
QGMLLTTYARTQASGGQLDRDELIRLLGECAELFKALGDYAGQHGGQAVDTAGQHAVAAAFKRWAPGTDG
ADAPSDGAARALMAFGAQAGSVNVTPKTHVTYAGENIDQVAQQHLQLMSGQRLNATAGQGMQLFARGAGV
QAVAGEGPMLLQAQAGTLTANAQKGVKITTNEHEVFVSAPKIRLVAEDGSYLELGGGITLGTNGDIKLLS
ASHQWGGPSTAQAAKSGFGNQPTDQRFKLHYPGEDGDLQAAANKRFRITLDDGRVIEGKTDASGLTDLVK
DDAMRIAKIDYLKPKL
 
Nucleotide Sequence: 2781 bp     [Download]
>gi|403521294|ref|NC_018529.1|:88359-91139 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
GTGACCAATTTGAACGATACGCTACGCAATTTTGCGTCGGGGGCGGTCGACTGGAATAAACGTCCGGTCG
CGTTGCACTTTGGCGCCGCGCAGGCCGCGCTGGGCCACCTCCTCGCGCTGCAGCACGCCAGTGTTCAGGA
AGGCCTGATGACCGGGATCCACGGCCGATTGACCTGCGTGTCGACCCGCCGCGACCTTCCGCCCGGCGTG
TTGCTCGGCATTCCGGTTTCGATCCGGCTCATTACCGACCGCGGACAGCCGCACACGGTGAACGCGATCA
TCAGCGGCGTCCAGATCGGCCAAAGCGACGGCGAGCTCTGTGTGTACCAGCTGACGGTCTGCGACGCGCT
GTCGCTGATGGACAAGCGCACCAATTCGCGGGTCTTCCGAAAGCGCAGCGTCATCGAGGTGCTCGCCACG
CTGTTCAACGAATGGCAGCAGCGCAGCCCGGCCCTCGCGCGCGCGTTCGAATTCGATCTGTCCGGCTTGC
GCGCCGATCGCTATCCGCCCCGCGAGCTGACCCGGCAGGTCAACGAATCGGATGCGCATTTCGTGCGCCG
TCTGCTGCGCCGCGAAGGGATCACCGTGTTCGCGAAGGCGGGGCCGGCGAAGGGCGAACGGCCGTTGCAG
GGCGACGCGCCCGTGCACACGCTCGTGTGCTGTGACGATCCGATGTCGTTGCCGCAAGCGCCGGCCGGCA
CGGTCCGCTTGCATCCGCGCGACGGCGGCGCCGCGCAGCGCGACACGGTCACGCTGTTCGCGCTGCGTCG
GCAATTGGCGCCCGGCAAGGCCGGGCGCCCGTCGTGGGACTACAAGAAGGCGCGGATCGACGAATCGAGC
GTCGCTTCGAGCCTCGATCAGGGCGAGGCGGGCAACGATCTGGCGAAGCTGCTGACCGACATCGCGATCG
ACATTGCGCACGCGGGCGATTCATGGCGCGATCACGAGCGGCTCACCCGCGCGCGCATGCTCGCGCACGA
GTTCGAAGCCGAGCGCCATGACGGCGTCAGCAGCGTGCGGGATCTCGCCGTGGGCACATGGATCACGCTG
ACGGGCGATCCGCAATGGGACAGGCAACGCGCCGACAAGCGTCAGTTCGTGATCACGTCGATCGATCACG
ACATCTGGAACAACCTGCCGAAGGGGCTCAACGAGCGCGTGCACGCGCTGTTCGCCGCGAGCCGCAATCT
CGCGTGCGCGCCCCGCGCGCTGCCGTCCGCGCTGGCGAACGACGCGGATACCCGCTACGAGAACACGTTC
GCGTGCGTGCGCCGCGGCGTGCCGCTTGCGCCCGCGTACGATCCGCAAGCCGATTTGCCGCCCGCGCATC
TGCTCACGGGCACGATTGTCGGCGCGGAGGGCGAAGAAGTGTTCTGCGACGAAGACGGCCGGGTGCGCGT
GCGGGTGCACGGCCTCGATCCGGCGGATCACGCGCACGCGCAGGGCGCGGGCACCAACGGCAACGCGGGC
GACAGCGCGCCGATCCGCGTGGCGTCGAGCCTCGCCGGCGCCTATTTCGGCGCATCGTTTCTGCCGCGAG
TCGGCATGGAAGTCCTTCTCGGGTGTCTCGGCGGCGATCCGGACCGGCTGGTGATCATCGGCGTGCTCGG
TAACGGCGCGCATCCGCCGGCGACGTTCAGCCACGCGGGCGGGCTGCCGGGCAACCGCTACCTGTCGGGC
ATCAAGACGAAGGAGATTCGTGGGCAACGGTACAACCAGCTGCGTCTCGACGACACGCCGAACCAGATCA
GCGCGCAACTGGCGAGCGAGCACGCGCATTCGCAGCTCAATCTCGGATATCTGACGCAACCGCGCGAGAA
CGGCCACGGGAACGACCGCGGCGAGGGCGTGGAGTTGCGTACCGACGCGGCGGCGGCGCTGCGGGCGGCG
CAAGGCATGCTGCTGACGACCTACGCGCGCACGCAGGCGAGCGGCGGGCAACTGGACCGTGACGAGCTGA
TTCGGTTGCTCGGCGAATGCGCGGAGCTGTTCAAGGCGCTGGGCGACTACGCGGGGCAGCACGGCGGGCA
GGCCGTGGATACGGCCGGCCAGCACGCGGTGGCCGCCGCGTTCAAGCGCTGGGCGCCGGGCACGGACGGC
GCCGATGCGCCGTCCGACGGCGCAGCGCGCGCGCTGATGGCGTTCGGCGCGCAGGCCGGTTCGGTGAACG
TCACGCCGAAGACGCATGTGACGTATGCCGGCGAGAACATCGATCAGGTCGCGCAGCAGCACCTGCAACT
GATGAGCGGCCAGCGGCTGAACGCGACGGCCGGGCAGGGCATGCAGCTCTTCGCGCGGGGCGCGGGGGTG
CAGGCCGTGGCGGGCGAAGGGCCGATGCTGCTGCAGGCGCAAGCCGGCACGCTGACGGCGAACGCGCAGA
AGGGCGTCAAGATCACGACGAACGAGCACGAGGTGTTCGTGAGCGCGCCGAAGATTCGGCTCGTTGCCGA
GGACGGCAGCTACCTCGAGCTCGGCGGCGGCATCACGCTCGGCACGAACGGCGACATCAAGCTGCTGTCG
GCGTCGCACCAGTGGGGCGGGCCGTCGACCGCGCAGGCGGCGAAGAGCGGGTTCGGCAATCAGCCGACGG
ATCAGCGTTTCAAGCTGCACTATCCGGGCGAGGACGGCGATTTGCAGGCGGCGGCGAACAAGCGGTTCCG
GATCACGCTGGACGACGGGCGCGTCATCGAAGGCAAGACCGACGCGAGCGGCCTGACGGATCTGGTCAAG
GACGACGCGATGCGTATCGCGAAGATCGACTATCTGAAGCCGAAGCTCTGA
 Primer design

Protein ID: 403521433
SecReT6 ID694
T6SS typei3
Gene symbol-
Locus tagBPC006_II0139
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]127450..130092 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDK7QAK3
KEGG IDbpq:BPC006_II0139
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.30E-78, Aligned region: 25..352
Phage_base_V [PF04717], Evalue: 8.20E-25, Aligned region: 392..485
Gp5_C [PF06715], Evalue: 0.0034, Aligned region: 536..556
Gp5_C [PF06715], Evalue: 0.0034, Aligned region: 569..585
Gp5_C [PF06715], Evalue: 0.0034, Aligned region: 577..598
Gp5_C [PF06715], Evalue: 0.0034, Aligned region: 597..614
Gp5_C [PF06715], Evalue: 0.0034, Aligned region: 602..621
Protein Sequence: 880 a.a.     [Download]
>gi|403521433|ref|YP_006657002.1| Rhs element Vgr protein [Burkholderia pseudomallei BPC006]
MIRSGAMPRLLGQPALEFLSLRGEEHLGKLYTYELLLRTPDDFHVPLATSANLDLKAMIGTEMTVCIQLD
GIGTGAQGGVGAGAREISGLVVKAGFLRCEGRYNVYRIELRPWLWLATLTSDYKIFQDKSVVEIIDTVLH
DYPYPVEKRLDIDKYSVAGESARNEPRAFQVQYGETDFDFVQRLMEEWGIYWFFEHSDNKHRLVLCDHIG
GHRKAPSEAYHEIAHHPEGGKIDIEYINYFSTDEALRPGRVVIDDFDFTRPLASLVTSNHQPRETNWGEG
ELFEWPGDYTDSKHGDLISRVRMEERRATGSRAYGRGNVRGLACGHTFVLSKHKHDGANREYLVIESALM
LTEVADETGSGYRYECDNELVVQPSNEVFRMPRETPKPTTSGPQSAIVVGPPGHEVWTDEFGRVKIRFLW
DRYARNDATDSCWVRVSQAWAGVNFGGIYIPRIGQEVIVGFMNGDPDRPLILGSLYNTITPPPWDLPGDA
TKSGFKSKSITGGRENYNGIRFEDKLGAEEFHMQAEKDMNRLTKNDESHTVGANFSIGVGLTHTRAVGAM
FSSIVGGAASYAVGGAESTMIGGAYALNVGGAHAVAVGGASSVSVGGAYARNVGGAYALTVGGVLSIVCG
ASSITMTACGSIKIVGKNIRIIGSDEVVVQGAPLQLNPGDSDCGGGGGGGGGGGAIPPIPLPSFFLDITK
PILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI
 
Nucleotide Sequence: 2643 bp     [Download]
>gi|403521294|ref|NC_018529.1|:127450-130092 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
GTGATCCGCAGCGGTGCGATGCCGCGGCTGCTCGGTCAGCCCGCGCTCGAGTTCCTGTCGCTGCGCGGTG
AAGAGCACCTCGGAAAACTCTACACGTACGAATTGCTCCTGCGCACGCCGGACGATTTTCATGTGCCGTT
GGCAACGAGCGCGAATCTCGACCTGAAGGCGATGATCGGCACGGAGATGACGGTCTGCATTCAGCTCGAC
GGAATCGGGACGGGCGCGCAAGGCGGCGTTGGCGCGGGTGCGCGCGAAATCAGCGGGCTCGTGGTCAAGG
CGGGCTTCCTGCGCTGCGAGGGGCGCTACAACGTCTATCGCATCGAGCTGCGCCCCTGGCTGTGGCTCGC
GACTTTGACGAGCGACTACAAGATTTTTCAGGACAAGAGCGTCGTCGAAATCATCGATACGGTCTTGCAC
GATTACCCTTACCCGGTCGAGAAGCGGCTCGACATCGACAAGTATTCGGTGGCGGGCGAGAGCGCTCGAA
ACGAGCCGCGCGCGTTCCAGGTGCAATATGGCGAAACCGATTTCGACTTCGTTCAGCGTTTGATGGAGGA
GTGGGGGATCTACTGGTTCTTCGAGCATTCGGACAACAAGCATCGCCTGGTCTTGTGCGATCACATCGGC
GGGCATCGCAAGGCGCCGAGCGAGGCCTATCACGAGATCGCGCATCACCCGGAAGGCGGGAAGATCGACA
TCGAGTACATCAACTATTTCTCGACGGACGAAGCGCTGCGGCCCGGCCGCGTCGTGATAGACGATTTCGA
CTTCACGCGTCCGCTCGCGAGCCTCGTCACGTCCAATCACCAGCCGCGGGAGACGAACTGGGGGGAGGGC
GAGCTGTTCGAATGGCCGGGCGACTATACCGATAGCAAGCATGGCGATCTCATCAGCCGCGTGCGCATGG
AAGAGCGCCGCGCGACCGGGTCGCGCGCATACGGTCGGGGCAACGTGCGCGGCCTCGCCTGCGGTCATAC
GTTCGTGCTGTCGAAGCACAAGCACGACGGCGCGAACCGCGAGTACCTCGTCATCGAATCGGCGTTGATG
CTGACCGAAGTCGCGGACGAAACGGGCAGCGGCTACCGCTACGAATGCGATAACGAACTGGTCGTGCAGC
CGTCGAACGAGGTGTTTCGAATGCCGCGCGAAACGCCCAAGCCGACGACGAGCGGGCCACAGTCCGCGAT
CGTGGTCGGGCCGCCGGGCCACGAGGTATGGACCGACGAATTCGGCCGCGTGAAGATCCGTTTTCTGTGG
GATCGCTACGCACGCAATGACGCAACGGATTCCTGCTGGGTACGCGTGAGCCAGGCGTGGGCCGGCGTGA
ACTTCGGCGGCATCTACATTCCGCGGATCGGACAGGAAGTGATCGTCGGATTCATGAACGGCGATCCGGA
CCGTCCGCTGATTCTCGGCAGCCTCTACAACACCATTACGCCGCCGCCTTGGGATCTGCCCGGCGACGCG
ACGAAGAGCGGATTCAAGAGCAAGTCGATCACGGGCGGGCGCGAGAACTATAACGGCATCCGCTTCGAGG
ACAAGCTGGGGGCCGAGGAATTTCACATGCAGGCGGAAAAGGACATGAACCGCCTGACGAAGAACGACGA
GTCGCATACGGTCGGCGCGAATTTTTCGATCGGCGTCGGGCTTACCCATACGCGCGCGGTGGGCGCCATG
TTCAGCAGCATCGTCGGCGGAGCCGCCAGCTATGCGGTGGGGGGCGCGGAATCGACGATGATCGGCGGCG
CGTATGCGTTGAACGTCGGCGGCGCGCACGCGGTTGCGGTGGGCGGCGCGTCGTCCGTTTCCGTTGGCGG
CGCCTACGCGCGCAACGTGGGCGGCGCGTATGCGCTGACAGTCGGCGGCGTGCTGTCGATCGTCTGCGGT
GCGTCTTCGATCACCATGACGGCTTGCGGCTCGATCAAGATCGTCGGCAAGAATATTCGCATCATCGGCA
GCGACGAAGTCGTCGTGCAAGGCGCGCCCCTGCAACTGAATCCGGGCGATTCGGATTGCGGCGGAGGGGG
CGGCGGCGGAGGCGGCGGCGGCGCGATTCCGCCGATTCCGTTGCCGTCGTTCTTCCTCGATATCACGAAG
CCGATTCTTCCGCCGCCGCCGCCGCCACCGACGGAGGTGCCACCGGATCCGACGCCGACGCCCACGCCGA
CGCCGACGCCGACGCCCACGCCGACGCCGACGCCGACGCCCACGCCGACGCCGACGCCGACGCCCACGCC
GACGCCGACGCCGACGCCCACGCCGACGCCCACGCCCACGCCCACGCCGACGCCGACGCCGACGCCGACG
CCGACGCCGACGCCCACGCCGACGCCCACGCCCACGCCGACGCCCACGCCCACGCCGACGCCCACGCCGA
CGCCCACGCCGACGCCAACGCCAACGCCAACGCCAACGCCGACGCCCACGCCCACGCCGACGCCCACGCC
GACGCCAACGCCGACGCCGACGCCGACGCCGACGCCGACGCCGACGCCCACGCCGACGCCCACGCCGACG
CCCACGCCCACGCCCACGCCGACGCCAACGCCAACGCCCACGCCGACGCCCACGCCCACGCCGACGCCGA
CGCCGACGCCAACGCCAACACCAACGCCAACTCCGACTAGTTCCGAGATTTAA
 Primer design