SecReT6
Protein ID: 403521397
SecReT6 ID693
T6SS typei4b
Gene symbol-
Locus tagBPC006_II0103
StrainBurkholderia pseudomallei BPC006
Repliconchromosome I [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]91153..93393 [+]
ProductType V secretory pathway, adhesin AidA
NoteBTH_II0090 (e)
UniProt IDK7PWJ7
KEGG IDbpq:BPC006_II0103
PDB IDNA
Domain hit(s) vs Pfam DUF3274 [PF11678], Evalue: 5.20E-121, Aligned region: 416..725
Abhydrolase_6 [PF12697], Evalue: 0.00014, Aligned region: 226..309
PGAP1 [PF07819], Evalue: 0.0027, Aligned region: 244..302
DUF900 [PF05990], Evalue: 0.0061, Aligned region: 37..46
DUF900 [PF05990], Evalue: 0.0061, Aligned region: 214..283
Thioesterase [PF00975], Evalue: 0.0063, Aligned region: 147..188
Thioesterase [PF00975], Evalue: 0.0063, Aligned region: 257..359
Protein Sequence: 746 a.a.     [Download]
>gi|403521397|ref|YP_006656966.1| Type V secretory pathway, adhesin AidA [Burkholderia pseudomallei BPC006]
MNGINDQCFTAARGAGVTMANRPGDRPVPIPRDLPGVVIFIHGVNDPGAAYATVERGLCQGLNERLSRSD
LRPGAYGRRYAAASAAKAEGDSVRYAEVLGDPDMYLYQRAETGGTHSMFLPFYWGYRASDDEIAKISHPG
EVKSRVADSDGNLMTRGQYQDIHGNRLDAHFGKGGGFFANATNNIPQMYSPGFEPDKLERTVMQNALAGN
TIFAGKSPERRYFVLAAARLANLIKTIRTIQPSALALEHGMDPQHETITVMGHSQGTIITLLAQAMLRQQ
GQRCVDCIIMVDTPYSLQFTQDGSQQTGHAKLKTLVDIVNAVTSEPHTIPELAELMIDSAHSCGRAGQNW
SKTQGKRPDKGGKHWITFDERDNRGKVYLYFCPEDTVVGLDKVRGIGTFGVPDEVPADGAAASRGKTMPA
MTVLEPKRFFQRMWTRLERDQDGRGKRSKVAVGTPPARVPVRDPFQRLTPGPDTDGTMLGTLVESGKNMA
LQASFKRNDIRFINGEQLKPAYEPDLYGGEVQKGGQVPGHADVAGLMRPDDVTKNVALGNQYAKFKWKDV
ATTDDPGAGIEPHKQAFNRGRPVDEQSHNWRIVPSRSLGSMLSAAATGGRYQTYVIQREETPDEVRKRMR
TDADQLEANNYHSGVLLSSENHRWVTAMDVAIGQAVTLDDPDWRQLLLLMADWKMTPDVYRNIQKCKNFE
RLDEHTREFVKACVDYYKTGRFPDEKYVPLTMPPLVTSELKVESKT
 
Nucleotide Sequence: 2241 bp     [Download]
>gi|403521294|ref|NC_018529.1|:91153-93393 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGAACGGAATCAACGATCAGTGTTTCACCGCCGCCCGCGGGGCGGGCGTGACGATGGCGAATCGGCCCG
GCGACCGGCCCGTGCCGATTCCGCGCGATCTGCCGGGCGTGGTGATCTTCATCCACGGCGTCAACGATCC
CGGGGCGGCTTATGCCACCGTGGAGCGCGGGCTGTGCCAGGGGCTCAATGAGCGCTTGTCGCGAAGCGAT
CTGCGGCCGGGGGCGTATGGCAGGCGGTATGCGGCTGCGTCGGCGGCGAAAGCCGAGGGCGATAGCGTTC
GGTATGCGGAAGTGCTGGGCGATCCGGACATGTATCTGTATCAACGTGCGGAGACCGGCGGTACTCACAG
CATGTTCCTGCCGTTCTACTGGGGCTATCGGGCGTCCGATGACGAGATCGCGAAGATCAGCCATCCGGGC
GAGGTCAAGAGCCGCGTGGCGGACAGCGACGGCAACCTGATGACGCGCGGCCAGTATCAGGACATCCACG
GCAACCGGCTCGACGCCCATTTCGGCAAGGGCGGCGGGTTTTTCGCCAACGCGACGAACAACATCCCGCA
GATGTACAGCCCGGGCTTCGAACCGGACAAGCTCGAGCGCACGGTCATGCAAAACGCGCTGGCCGGCAAT
ACGATCTTCGCCGGCAAGTCGCCCGAGCGCCGTTACTTCGTGCTGGCCGCGGCTCGCCTGGCGAATCTCA
TCAAGACCATTCGGACCATTCAGCCCTCCGCGCTCGCGCTCGAACATGGAATGGACCCTCAGCACGAAAC
GATCACGGTGATGGGGCACAGCCAGGGCACGATCATCACGCTGCTCGCGCAGGCGATGCTCAGGCAGCAA
GGGCAGCGCTGCGTCGATTGCATCATCATGGTCGATACGCCGTACAGCCTGCAGTTCACCCAGGACGGCA
GCCAGCAAACCGGGCACGCGAAGCTCAAGACGCTGGTCGACATCGTCAACGCGGTGACGAGCGAGCCGCA
TACGATTCCGGAGCTGGCCGAACTGATGATCGATTCGGCCCATTCGTGCGGCCGGGCCGGACAGAACTGG
AGCAAGACGCAGGGAAAGCGGCCGGACAAGGGCGGCAAGCACTGGATCACGTTCGACGAGCGCGACAACC
GCGGCAAGGTCTATCTGTACTTTTGCCCGGAAGATACCGTGGTCGGCCTCGACAAGGTGCGGGGGATCGG
CACGTTCGGCGTGCCCGACGAGGTGCCGGCCGATGGCGCGGCGGCCAGCCGGGGCAAAACGATGCCCGCG
ATGACGGTGCTTGAGCCGAAGCGCTTCTTTCAGCGCATGTGGACGCGGCTCGAGCGCGACCAGGACGGCA
GGGGGAAGCGCTCGAAGGTCGCCGTCGGCACGCCGCCCGCGCGCGTGCCGGTTCGCGACCCGTTTCAGCG
ATTGACGCCGGGCCCCGACACGGACGGCACGATGCTTGGCACCTTGGTCGAATCCGGCAAGAACATGGCG
CTGCAGGCATCGTTCAAGCGCAACGACATTCGCTTCATCAACGGCGAGCAACTGAAACCGGCGTACGAGC
CCGATCTGTACGGGGGCGAGGTTCAGAAGGGCGGACAGGTGCCCGGGCACGCCGATGTCGCCGGGTTGAT
GCGTCCGGACGACGTGACGAAAAACGTCGCGCTCGGCAACCAGTACGCGAAGTTCAAATGGAAAGACGTC
GCGACGACGGACGATCCGGGCGCCGGCATCGAGCCGCACAAGCAGGCATTCAATCGCGGCCGTCCGGTCG
ACGAGCAGTCGCATAACTGGCGCATCGTGCCGAGCCGGTCGCTCGGCTCGATGCTGTCGGCGGCCGCCAC
GGGCGGACGGTATCAGACGTACGTGATCCAGCGCGAGGAGACGCCGGACGAGGTTCGCAAGCGCATGCGT
ACCGATGCCGATCAACTGGAAGCGAACAACTATCATTCGGGCGTACTGCTCAGTTCGGAGAACCATCGCT
GGGTCACGGCGATGGATGTGGCGATCGGTCAGGCGGTGACGCTGGATGATCCGGACTGGCGGCAGTTGTT
GCTTTTGATGGCGGATTGGAAGATGACGCCGGACGTGTATCGCAATATCCAGAAATGCAAGAACTTTGAG
CGCTTGGACGAACACACGCGCGAATTCGTGAAAGCGTGTGTCGACTACTACAAGACGGGCCGATTTCCCG
ACGAGAAGTATGTACCTCTCACCATGCCACCGCTCGTGACCAGCGAACTGAAGGTTGAGAGCAAAACATG
A
 Primer design