SecReT6
Protein ID: 403521422
SecReT6 ID694
T6SS typei3
Gene symbol-
Locus tagBPC006_II0128
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]114527..116155 [+]
ProductOmpA family protein
NoteTagL
UniProt IDK7PWL3, K7PWL3
KEGG IDbpq:BPC006_II0128
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 9.70E-19, Aligned region: 425..521
DUF218 [PF02698], Evalue: 0.00058, Aligned region: 430..501
Protein Sequence: 542 a.a.     [Download]
>gi|403521422|ref|YP_006656991.1| OmpA family protein [Burkholderia pseudomallei BPC006]
MVLASLCLPLRMQLDWSHVLTIVLIIAAIVLAIEIFEHSRETAQDRAAEAEIDDHELAVIIVAGPHASSL
FNSSGDDTAFRREAGALWLRADSVEQLRDTMMRVKASRGRFPDAAVVPLVSESDDESDMRQAFAKWRTEL
REALCYPDAAYVLPCYLAVYTCLGFKGADGARPKWTGDAIEIGTRQMNAASKVGELLASIRQQLLRPSPT
GSSAQCALGLGVFDWLDATALLSSMTMLANTPPFMLKGLTLADVGRRPIRPGAWTRWLTVRTGLHIRQTK
SSMAPLPVPRVAKHAESGIREGWSSARHLVSTRASFVPALVFSTVSTLGIAVAVSGWMNCRMIQRVSNDI
ADYRSGADEWIGRKRFAQARLEHDRTAIVQTLLDGVPTGFGWGLYRGQELLVKLDTVLDSPRTASIAMQL
DTVSLFAAGKATFSPGAAQRELQHALRMILANPEQRVLIVGHADSSGSDAANFQLSEARARAIRDWFVDQ
GVLKTRFIVQGAGDTHPIADNDSPSGRAQNRRVEVLLIPDVASDRKASGTEL
 
Nucleotide Sequence: 1629 bp     [Download]
>gi|403521294|ref|NC_018529.1|:114527-116155 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
GTGGTGCTCGCGAGCCTTTGCCTGCCGTTGCGCATGCAGCTGGATTGGTCTCATGTGCTGACCATCGTTC
TGATCATTGCCGCCATCGTGCTGGCGATCGAAATATTCGAACACTCTCGCGAGACAGCGCAAGACCGAGC
GGCCGAAGCCGAAATCGACGATCACGAGCTGGCGGTGATCATCGTCGCGGGCCCTCACGCATCGTCGCTT
TTCAATAGCAGCGGGGACGATACGGCGTTTCGGCGCGAAGCCGGCGCGTTATGGCTGCGCGCCGACAGCG
TCGAGCAATTGCGAGACACGATGATGCGCGTCAAGGCGTCGCGCGGACGGTTCCCGGACGCCGCCGTGGT
GCCGCTCGTATCGGAAAGCGATGACGAAAGCGACATGAGGCAGGCGTTCGCGAAGTGGCGAACCGAACTC
CGCGAAGCGCTTTGCTATCCCGATGCGGCCTATGTCCTGCCTTGCTATCTCGCCGTCTACACGTGTCTTG
GATTCAAGGGAGCCGACGGCGCGCGTCCGAAGTGGACGGGCGATGCAATAGAAATCGGCACGAGGCAGAT
GAATGCCGCATCGAAAGTGGGCGAGCTGCTCGCATCGATTCGACAACAACTGCTTCGGCCGTCGCCCACC
GGTTCGTCGGCGCAGTGCGCGCTGGGGCTCGGCGTGTTCGATTGGCTCGACGCCACGGCGCTGCTGTCGT
CGATGACCATGCTGGCGAATACCCCGCCATTCATGCTGAAAGGGTTGACGCTCGCGGATGTCGGCAGACG
GCCGATACGTCCGGGAGCGTGGACGCGCTGGCTCACTGTTCGGACCGGTCTCCATATTCGCCAGACCAAA
TCGTCGATGGCGCCGCTTCCCGTGCCGCGCGTGGCGAAGCATGCCGAAAGCGGCATTCGGGAAGGATGGA
GCAGCGCGCGCCATCTCGTTTCCACTCGTGCGAGCTTCGTGCCGGCGCTCGTGTTCTCCACTGTTTCGAC
GCTGGGCATCGCCGTGGCGGTCTCGGGCTGGATGAACTGCCGCATGATCCAGCGGGTGTCGAACGATATC
GCGGATTATCGGAGCGGAGCCGACGAGTGGATCGGGAGGAAGCGCTTTGCGCAGGCCCGCCTCGAACACG
ATCGCACGGCGATCGTGCAGACGCTGCTCGATGGCGTACCGACCGGTTTCGGCTGGGGACTCTACCGGGG
GCAGGAGTTGCTGGTCAAGCTCGATACGGTGCTGGATTCGCCGCGCACGGCGTCGATCGCGATGCAGCTC
GACACGGTATCGCTGTTCGCCGCGGGCAAGGCTACATTTTCTCCGGGCGCCGCGCAGCGTGAGTTGCAAC
ATGCATTGCGGATGATTCTCGCCAATCCGGAACAACGTGTGCTGATCGTCGGTCATGCAGACAGCTCCGG
CTCGGATGCGGCCAATTTTCAGTTATCCGAAGCGCGTGCGCGCGCGATTCGTGACTGGTTCGTCGATCAA
GGCGTGCTGAAGACGCGCTTCATCGTGCAAGGAGCCGGCGATACGCATCCGATCGCCGATAACGACAGCC
CTTCGGGACGTGCGCAGAATCGCCGTGTCGAGGTCTTGCTGATTCCGGACGTTGCTTCCGACAGGAAGGC
GAGCGGTACGGAACTATAG
 Primer design