SecReT6
Protein ID: 403521424
SecReT6 ID694
T6SS typei3
Gene symbol-
Locus tagBPC006_II0130
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]116545..117084 [+]
Producthypothetical protein
NoteTssB
UniProt IDK7PXL9
KEGG IDbpq:BPC006_II0130
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.50E-61, Aligned region: 11..163
Protein Sequence: 179 a.a.     [Download]
>gi|403521424|ref|YP_006656993.1| hypothetical protein BPC006_II0130 [Burkholderia pseudomallei BPC006]
MAISNSSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPAVGDRKFFSIDIDNF
DERMKAMKPRVAFSVPNTLSGDGQLMVDITFESMDDFSPAAIAKKVDALSQLLDARTQLANLQTYMDGKS
GAENLVSKVLKDPALLSALAKAPKPVAEQAENRESKEKH
 
Nucleotide Sequence: 540 bp     [Download]
>gi|403521294|ref|NC_018529.1|:116545-117084 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGGCTATATCCAATAGCTCACAGAAATTTATCGCGCGCAATCGTGCGCCTCGCGTTCAGATCGAATACG
ACGTCGAGATTTACGGTTCCGAAAAGAAGGTCGAGCTTCCGTTCGTGATGGGCGTGCTCGCGGACCTGTC
GGGCAAGCCGCTCGAGCCTCTGCCGGCGGTCGGCGACCGCAAGTTCTTCAGCATCGATATCGACAATTTC
GACGAGCGCATGAAGGCGATGAAGCCGCGTGTCGCGTTCTCGGTGCCGAATACTCTTTCCGGCGACGGTC
AATTGATGGTCGACATCACGTTCGAAAGCATGGACGACTTTTCTCCCGCGGCGATCGCGAAGAAGGTGGA
TGCGTTGTCGCAATTGCTGGACGCGCGCACGCAGCTTGCCAATCTGCAGACCTACATGGACGGAAAGTCG
GGCGCGGAGAACCTCGTGAGCAAGGTGCTCAAGGATCCCGCGCTGCTGAGCGCGCTTGCGAAGGCGCCGA
AGCCCGTGGCGGAACAGGCGGAAAACAGGGAATCGAAGGAAAAGCACTGA
 Primer design