SecReT6
Protein ID: 403521425
SecReT6 ID694
T6SS typei3
Gene symbol-
Locus tagBPC006_II0131
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]117118..118617 [+]
Producthypothetical protein
NoteTssC
UniProt IDK7Q667
KEGG IDbpq:BPC006_II0131
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-196, Aligned region: 66..493
Protein Sequence: 499 a.a.     [Download]
>gi|403521425|ref|YP_006656994.1| hypothetical protein BPC006_II0131 [Burkholderia pseudomallei BPC006]
MAARESQARSADAQLATHSDFNALLSREFKPKTEQAREAVEHAVKTLAEQALANSVTLSDDAYKSIEAII
GEIDRKLSEQINLILHHDDFQQLESAWRGLHHLVTNTETDEKLKIRFMDVSKDDLRRTMKRYKGVAWDQS
PFFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLSSIGKVAAAAHAPFITGASPSVLQMDSWQELA
NPRDLTKIFTQNLEYAPWNSLRNSEDARYIGLAMPRFLARLPYGIRTNPVDEFDFEESTDGSDHRKYVWA
NAAYAMAVNINRSFKHYGWCTLIRGVESGGVVENLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGF
IPLIHRKNTDYAAFIGAQSLQKPAEYYDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERED
MQQWLNEWIMNYVDADPANSSQETKARRPLAAAEVVVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVA
KLPSVKEAA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|403521294|ref|NC_018529.1|:117118-118617 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGGCTGCACGTGAATCTCAGGCGCGCTCCGCCGATGCACAGCTCGCTACGCACTCGGACTTCAATGCCC
TGCTGTCGCGCGAGTTCAAACCGAAGACCGAACAGGCGCGCGAGGCGGTGGAACATGCCGTCAAGACGCT
GGCCGAGCAGGCGCTCGCCAATTCTGTGACGTTGTCGGACGACGCGTACAAGAGCATCGAAGCGATCATC
GGCGAAATCGATCGAAAGCTGTCCGAGCAGATCAACCTGATTCTGCATCACGACGATTTCCAGCAGCTGG
AAAGCGCATGGCGCGGCCTGCATCATCTGGTGACGAATACCGAGACGGACGAGAAGCTCAAGATCCGCTT
CATGGACGTCTCCAAAGACGATCTGCGCCGTACGATGAAGCGATACAAAGGCGTGGCCTGGGACCAGAGC
CCGTTTTTCAAGCAGATCTACGAAGAGGAATACGGTCAGCTCGGCGGCGAGCCGTATGGATGCCTCGTGG
CCGACTACTACTTCGACCACACGCCGCCGGACGTCGATCTGCTTTCGTCGATCGGCAAGGTGGCGGCTGC
CGCGCACGCTCCGTTCATTACCGGCGCATCGCCTTCGGTACTCCAGATGGATTCCTGGCAAGAGCTGGCC
AATCCGCGCGACCTGACGAAGATCTTCACGCAGAACCTCGAATATGCGCCCTGGAATTCGCTGCGCAATT
CCGAAGATGCCCGTTATATCGGTCTTGCGATGCCGCGCTTCCTCGCACGCTTGCCGTATGGAATCAGGAC
GAATCCCGTCGACGAATTCGATTTCGAGGAATCGACGGATGGGTCCGATCATCGCAAGTACGTGTGGGCG
AATGCCGCGTATGCGATGGCGGTCAACATCAATCGCTCGTTCAAGCATTACGGCTGGTGCACGCTGATTC
GCGGTGTGGAAAGCGGCGGCGTCGTCGAGAACCTGCCTTGCCATACGTTCCCGACGGACGACGGCGGCAT
CGACATGAAGTGTCCGACCGAAATCGCGATTTCCGATCGCCGCGAAGCGGAGCTCGCGAAGAACGGCTTC
ATTCCGCTGATCCATCGAAAGAACACCGACTACGCGGCATTCATCGGAGCGCAATCGCTGCAGAAGCCGG
CCGAGTACTACGACCCGGACGCCACCGCGAACGCGAACCTGTCCGCCCGCCTGCCGTACCTGTTCGCGTG
CTCGCGCTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCAAGGAGCGCGAAGAC
ATGCAGCAGTGGCTCAACGAATGGATCATGAACTATGTCGACGCCGACCCGGCGAACTCGTCGCAGGAGA
CCAAGGCGCGCCGTCCGCTGGCCGCGGCCGAAGTGGTTGTCGAAGACGTGGAAGGCAATCCGGGCTACTA
CCAGGCGAAGTTCTTCCTGCGTCCGCACTTCCAGCTGGAAGGGTTGACCGTGTCGCTGCGCCTCGTCGCG
AAGCTGCCCTCGGTCAAGGAAGCGGCGTAA
 Primer design