SecReT6
Protein ID: 403521426
SecReT6 ID694
T6SS typei3
Gene symbol-
Locus tagBPC006_II0132
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]118817..119299 [+]
ProductSciM protein
NoteTssD
UniProt IDK7Q5G7
KEGG IDbpq:BPC006_II0132
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.00E-40, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|403521426|ref|YP_006656995.1| SciM protein [Burkholderia pseudomallei BPC006]
MSHDIFLKINGIDGEAEDATHKSEIEVLSWSWNVSQQSNMHLGSGGGAGKATIDDLQFEHYIDRASPNLV
QYCLLGKHIDEARLVVRKAGGSPLEYIKLTMSDVLVTQVSPAGVAQDESRPRELVRLSFSRLKQEYVVQN
PQGGSGGAITATFDIKKNAA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|403521294|ref|NC_018529.1|:118817-119299 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGTCGCACGACATTTTCCTCAAGATCAACGGTATCGATGGCGAGGCGGAAGACGCAACCCACAAGAGCG
AAATCGAGGTCTTGAGCTGGTCGTGGAACGTCAGTCAGCAATCGAACATGCACCTGGGTTCGGGGGGCGG
CGCGGGCAAGGCGACGATCGATGATCTGCAGTTCGAACATTACATCGATCGCGCGAGCCCGAATCTCGTT
CAATACTGCTTGCTCGGCAAGCATATCGACGAAGCCCGGCTCGTGGTGCGTAAGGCGGGCGGCAGCCCGC
TCGAATACATCAAGCTCACGATGAGCGATGTGCTCGTTACGCAGGTGAGCCCGGCAGGCGTGGCTCAGGA
CGAATCGCGCCCGCGTGAGCTCGTTCGGCTGTCGTTCTCGCGCCTGAAGCAAGAGTATGTCGTCCAGAAC
CCGCAGGGCGGCAGCGGCGGCGCAATCACCGCGACTTTCGACATCAAGAAGAACGCGGCGTAA
 Primer design