SecReT6
Protein ID: 403521427
SecReT6 ID694
T6SS typei3
Gene symbol-
Locus tagBPC006_II0133
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]119337..119969 [+]
ProductSciN protein
NoteTssJ
UniProt IDK7PWL7
KEGG IDbpq:BPC006_II0133
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.80E-36, Aligned region: 56..204
Protein Sequence: 210 a.a.     [Download]
>gi|403521427|ref|YP_006656996.1| SciN protein [Burkholderia pseudomallei BPC006]
MGRGPEAAVRGARIASAANSGFSRGDRIIQMAFPFFFRREAARRTAVKRVVAAMVCASLAACASLPARKE
TADLIVKIKVSEGANPDEHQRPAPVMVRLYELKSAGAFENADFFTLQSDSRKVLGDDAIATDEFVMRPGD
TRDIHRRADSAGTSVGVLVGYRELGKSVWRAVHKLRPAPEDAWYRAFTPRTKIKLNVDVGQQTVTITELE
 
Nucleotide Sequence: 633 bp     [Download]
>gi|403521294|ref|NC_018529.1|:119337-119969 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
GTGGGGCGAGGCCCGGAGGCTGCTGTTCGCGGCGCTCGTATCGCGAGCGCCGCGAACAGCGGCTTTTCCC
GGGGCGACAGGATCATCCAGATGGCTTTCCCATTTTTCTTTCGCCGCGAAGCGGCCAGGCGAACCGCCGT
CAAGCGCGTTGTGGCGGCAATGGTATGCGCATCGCTCGCGGCTTGCGCAAGCTTGCCGGCACGCAAGGAA
ACAGCCGATCTGATCGTGAAGATCAAGGTGAGCGAAGGCGCCAATCCGGATGAGCATCAGCGCCCGGCGC
CCGTGATGGTGCGGCTGTACGAGCTGAAATCGGCCGGCGCGTTCGAGAACGCCGATTTTTTCACGCTACA
GAGCGACAGCCGCAAGGTGTTGGGTGACGACGCGATCGCGACGGATGAATTCGTGATGCGCCCGGGCGAC
ACCCGGGATATTCATCGGCGTGCCGATTCCGCGGGGACGTCGGTCGGCGTGCTGGTCGGTTATCGAGAGC
TCGGCAAATCGGTGTGGCGGGCGGTCCATAAGCTGCGGCCGGCTCCGGAAGATGCATGGTACCGGGCATT
CACGCCAAGGACGAAAATCAAGTTGAACGTCGATGTCGGGCAGCAGACGGTGACGATTACAGAATTGGAA
TGA
 Primer design