SecReT6
Protein ID: 403521428
SecReT6 ID694
T6SS typei3
Gene symbol-
Locus tagBPC006_II0134
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]119966..121324 [+]
Producthypothetical protein
NoteTssK
UniProt IDK7QAK0
KEGG IDbpq:BPC006_II0134
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-143, Aligned region: 23..450
Protein Sequence: 452 a.a.     [Download]
>gi|403521428|ref|YP_006656997.1| hypothetical protein BPC006_II0134 [Burkholderia pseudomallei BPC006]
MIAMSWHNKVVWNEGLFLLPQLFQQQERYFEYFAHKRAAVLSPFFWGFSRYEIDQESLSFGKLVFKSGAG
IFPDGTPFDVPGHTPPPPPLTIAAEHQDQVIYLAVPLRLPNTEETAFDEQAGSLARYSAFEIELRDSNAI
GQGPKPVQLANMRLRLLPEKELTQSWIGIALTRVKTLHADGSVALYDGDHIPPVSQYGANPLLREWATQL
HGLAKLRADALATRLSGSDGRAGAAAEVADYLLLQVLNRYEPLLEHICRIREMPPVTLYRELSMLAGELS
TFVRPQTRRPRPTPGYDHAQLYASIRPLVDEVHYLLNQVLIRGAQPIPLTEQPHGIRVATMLPSELAGYS
SLVLAVGAQMSPDVLQQQFASQTKISHPQRLPELIRSHLPGMTMIPLPVPPRQIPFNSSYIYYELSRTGP
FWEQIAQQGGLAMHIAGHFPELKLELWGVRHK
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|403521294|ref|NC_018529.1|:119966-121324 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGATTGCGATGAGTTGGCATAACAAAGTGGTGTGGAACGAAGGACTGTTTCTTCTTCCCCAGCTGTTTC
AACAACAGGAACGGTATTTCGAATATTTCGCGCACAAGCGGGCCGCGGTCCTCAGCCCGTTTTTCTGGGG
ATTCAGCCGATACGAAATCGATCAGGAGTCGCTATCGTTCGGCAAGCTCGTGTTCAAGAGCGGTGCGGGA
ATATTTCCCGACGGAACGCCGTTCGACGTGCCGGGGCACACGCCGCCGCCGCCGCCGCTGACGATCGCCG
CCGAGCATCAGGATCAGGTGATTTATCTCGCGGTGCCGCTGCGTCTACCGAATACGGAGGAGACCGCGTT
CGACGAACAAGCGGGATCGCTTGCGCGCTATTCGGCGTTCGAGATCGAATTGCGCGACAGCAATGCGATC
GGTCAAGGGCCCAAGCCGGTACAGCTCGCGAACATGCGGCTGCGCCTGCTGCCGGAAAAGGAGCTGACGC
AGTCCTGGATCGGTATTGCCTTGACGCGCGTGAAGACGCTTCACGCCGACGGCTCGGTCGCGCTGTACGA
CGGTGACCACATCCCGCCCGTCAGCCAGTACGGAGCGAACCCGCTGCTGCGCGAATGGGCGACCCAGTTG
CACGGCCTCGCGAAACTGCGAGCCGACGCGCTGGCGACGCGCCTGTCCGGCAGCGATGGCCGGGCCGGGG
CGGCGGCCGAGGTGGCGGATTATTTGTTGCTGCAGGTGCTGAACCGGTATGAACCGCTGCTCGAGCACAT
CTGCAGGATTCGCGAAATGCCGCCCGTCACGCTCTATCGCGAGCTGTCGATGCTGGCAGGCGAATTGTCG
ACGTTCGTGCGCCCGCAAACGCGCCGTCCGCGGCCGACGCCCGGTTACGATCATGCGCAGTTGTATGCGA
GCATTCGCCCGCTGGTCGACGAGGTGCACTACCTGTTGAACCAGGTTCTGATTCGAGGCGCGCAGCCGAT
CCCGCTCACCGAGCAGCCGCACGGCATTCGCGTGGCCACGATGTTGCCGTCGGAACTCGCGGGCTATTCG
AGCCTCGTGCTCGCCGTGGGCGCGCAAATGTCGCCGGACGTGTTGCAGCAGCAGTTCGCATCCCAAACGA
AGATCAGCCATCCGCAGCGGCTGCCGGAGCTCATTCGCTCTCATTTGCCGGGCATGACGATGATTCCGTT
GCCGGTGCCTCCGCGGCAGATTCCGTTCAATTCCAGCTATATCTATTACGAGCTATCCCGCACGGGGCCG
TTCTGGGAACAGATTGCGCAACAAGGCGGGCTGGCGATGCACATCGCGGGCCACTTCCCTGAACTCAAGC
TCGAACTTTGGGGAGTGCGTCACAAATGA
 Primer design