SecReT6
Protein ID: 403521429
SecReT6 ID694
T6SS typei3
Gene symbol-
Locus tagBPC006_II0135
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]121321..122622 [+]
Producthypothetical protein
NoteTssL
UniProt IDK7PXM2
KEGG IDbpq:BPC006_II0135
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-61, Aligned region: 62..268
OmpA [PF00691], Evalue: 6.50E-18, Aligned region: 21..36
OmpA [PF00691], Evalue: 6.50E-18, Aligned region: 327..425
Protein Sequence: 433 a.a.     [Download]
>gi|403521429|ref|YP_006656998.1| hypothetical protein BPC006_II0135 [Burkholderia pseudomallei BPC006]
MNSGAFDEAAFDFLVSDEGGANVAADRARSAAKAAGAEPARDRIDASVNVQHRLDEVRAAANPLLEAATP
LLRMLADMPATLDTSEAVASLRTLLVREVALFQNLCEKADLPWKHMAVVRYCLCTALDEAANRTRWGGGG
VWASQSLLITYEGEVDGGEKFFLLIGRMATDPQEYVDILEILYRVLGLGFEGRYSVVADGRRHLEQIRQR
LWTLITGARDAIQPELSLRWRGAEPGRLPLLRSVPAWASGALVFLLLFGLFAFYQYRLLTERNALEARIL
AIAKDEPAPPPQRLRLSILLKNEIARGLLTVDEDDRRSVVVFRGDSMFRSGESRVLPEIEPVLDKVAREV
ARVGGRVTVTGHSDNQPIRRADIPNNLVLSEKRAAYVAQILVQRGTPADRIRSEGRGDAQPVAENATPAG
RSRNRRVEIAVTL
 
Nucleotide Sequence: 1302 bp     [Download]
>gi|403521294|ref|NC_018529.1|:121321-122622 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGAATTCGGGCGCCTTTGACGAAGCCGCGTTCGATTTTCTCGTATCGGACGAAGGCGGAGCGAACGTCG
CGGCCGATCGCGCGCGATCGGCCGCGAAGGCCGCGGGCGCGGAGCCGGCGCGCGATCGGATCGACGCGTC
GGTCAACGTCCAGCATCGCCTCGACGAAGTTCGCGCGGCGGCCAATCCGCTGCTCGAAGCCGCGACGCCT
TTGCTGCGGATGCTGGCGGACATGCCTGCGACGCTAGACACCTCCGAAGCCGTCGCGAGCCTTCGCACGC
TGCTCGTGCGAGAGGTCGCGCTGTTCCAGAACTTGTGCGAGAAGGCCGATTTGCCTTGGAAGCACATGGC
GGTCGTGCGTTATTGCCTGTGCACGGCACTGGACGAGGCGGCCAATCGCACGCGCTGGGGCGGCGGCGGC
GTATGGGCTTCGCAGAGCTTGCTGATTACATACGAAGGCGAGGTCGACGGAGGCGAGAAGTTCTTCCTGT
TGATCGGACGCATGGCGACGGATCCTCAGGAGTACGTCGATATTCTCGAGATTCTCTATCGCGTGCTGGG
TCTCGGGTTCGAAGGGCGCTACAGCGTCGTTGCGGACGGCCGGCGGCATCTCGAGCAGATTCGCCAGCGT
TTGTGGACGCTCATCACCGGCGCGCGCGACGCGATTCAGCCGGAATTGTCGCTGCGCTGGCGCGGAGCGG
AGCCGGGCAGGCTTCCGCTATTGCGCAGCGTGCCCGCATGGGCGAGCGGTGCGCTCGTCTTCCTGCTGTT
GTTCGGTCTCTTCGCGTTCTATCAGTATCGGTTGCTCACCGAACGCAATGCGCTCGAGGCGCGCATCCTG
GCGATCGCGAAGGACGAGCCGGCGCCGCCACCGCAGCGTTTGCGCCTGTCGATCCTGCTCAAGAACGAAA
TTGCGCGCGGTCTACTGACGGTCGACGAAGACGATAGGCGCAGCGTGGTCGTGTTCCGTGGCGATTCGAT
GTTCCGCTCCGGCGAGAGCCGCGTGCTTCCCGAGATCGAGCCGGTGCTCGACAAGGTGGCGCGGGAAGTG
GCCCGCGTCGGCGGCCGGGTCACGGTCACGGGGCACTCCGACAACCAGCCGATTCGGCGCGCCGACATCC
CGAACAACCTCGTGTTGTCGGAAAAACGCGCGGCTTACGTCGCGCAAATCCTGGTCCAGCGAGGCACTCC
GGCCGATCGTATTCGCTCGGAGGGCCGGGGCGACGCGCAGCCCGTCGCGGAAAACGCGACGCCTGCTGGC
CGATCCCGCAACCGCCGCGTCGAAATCGCGGTCACGCTGTAA
 Primer design

Protein ID: 403521421
SecReT6 ID694
T6SS typei3
Gene symbol-
Locus tagBPC006_II0127
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]113787..114476 [+]
Producthypothetical protein
NoteTssL
UniProt IDK7Q5G5
KEGG IDbpq:BPC006_II0127
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-30, Aligned region: 8..205
Protein Sequence: 229 a.a.     [Download]
>gi|403521421|ref|YP_006656990.1| hypothetical protein BPC006_II0127 [Burkholderia pseudomallei BPC006]
MSIEMPAQPLRMLLQDTMLHVALLTQGARISRVHDWRARCIALVRQFEQALQDGGYRGGIANELGLAQCV
FLDEITMRNLSTEQKEEWLRELLQFRFHSIRDGLSKVRARIDRLCRGHSANAALLEMYSLFHEFGLLGDK
QGHALADARVSEARPTPGKKAVETAEIWKDGGAANEAAHGRSWRIVGGLLAFAALMTMWLVIDTRLSHEV
EQMEVTSGDEAAIHPASGD
 
Nucleotide Sequence: 690 bp     [Download]
>gi|403521294|ref|NC_018529.1|:113787-114476 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGTCGATTGAAATGCCCGCGCAGCCGCTGCGCATGTTATTGCAGGACACGATGCTCCATGTCGCGCTAT
TGACGCAAGGCGCGCGCATATCGCGCGTGCATGACTGGCGCGCGCGCTGCATCGCGCTCGTCAGGCAATT
CGAGCAGGCGCTGCAGGACGGCGGCTACCGCGGCGGTATTGCCAATGAATTGGGCCTCGCGCAATGCGTT
TTTCTGGACGAGATCACGATGCGCAATCTGTCGACCGAGCAAAAGGAAGAATGGTTGCGTGAGCTCCTTC
AGTTCCGTTTCCACTCGATTCGGGATGGGTTGAGCAAAGTGCGTGCGCGTATCGATCGCCTTTGCCGCGG
GCATTCGGCGAATGCCGCATTGCTGGAAATGTATTCGTTGTTCCATGAATTCGGTCTCCTGGGAGACAAG
CAAGGACACGCGTTAGCCGACGCGCGGGTGTCAGAGGCAAGGCCGACGCCCGGAAAGAAAGCCGTGGAAA
CGGCGGAGATTTGGAAGGACGGGGGGGCCGCCAATGAAGCGGCGCACGGACGCTCTTGGCGAATCGTCGG
CGGCCTGCTGGCGTTTGCGGCGCTCATGACGATGTGGCTCGTTATCGACACACGTCTGAGCCATGAAGTG
GAACAGATGGAAGTCACGTCCGGAGATGAAGCAGCGATTCATCCGGCATCGGGGGATTGA
 Primer design