SecReT6
Protein ID: 403521434
SecReT6 ID694
T6SS typei3
Gene symbol-
Locus tagBPC006_II0140
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]130188..130436 [+]
ProductPAAR motif-containing protein
NotePAAR
UniProt IDK7PXM6
KEGG IDbpq:BPC006_II0140
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.50E-14, Aligned region: 2..74
PAAR_motif [PF05488], Evalue: 2.50E-14, Aligned region: 65..81
Protein Sequence: 82 a.a.     [Download]
>gi|403521434|ref|YP_006657003.1| PAAR motif-containing protein [Burkholderia pseudomallei BPC006]
MGDAIGHGGVLVTGSGDVFMNGIPAGFVAGSVAVCALHASAQAVVAASGTVFINRLPAAFVGGVTSCGAP
IVSGSPDVMIGS
 
Nucleotide Sequence: 249 bp     [Download]
>gi|403521294|ref|NC_018529.1|:130188-130436 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
GTGGGAGATGCGATCGGACATGGCGGCGTTCTCGTCACCGGCTCAGGTGACGTATTCATGAACGGCATTC
CCGCGGGATTCGTCGCCGGCAGCGTCGCCGTGTGCGCGCTGCATGCGTCCGCGCAGGCGGTGGTCGCCGC
ATCGGGAACGGTATTCATCAATCGCCTCCCGGCTGCGTTCGTCGGTGGCGTGACGTCGTGCGGCGCGCCG
ATCGTTTCAGGCTCGCCCGACGTCATGATCGGCTCATAA
 Primer design